CXCL14/BRAK Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CXCL14 (also known as breast and kidney-expressed chemokine (BRAK)), as a non-ELR CXC chemokine. CXCL14 displays chemotactic activity for monocytes but not for B and T cells. CXCL14 is involved in cancer, immune responses, and epithelial cell proliferation and migration. CXCL14 is a potent inhibitor of angiogenesis, and also shows antimicrobial activity. CXCL14/BRAK Protein, Human is produced in E. coli, and consists of 77 amino acids (S35-E111).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL14 (also known as breast and kidney-expressed chemokine (BRAK)), as a non-ELR CXC chemokine. CXCL14 displays chemotactic activity for monocytes but not for B and T cells. CXCL14 is involved in cancer, immune responses, and epithelial cell proliferation and migration. CXCL14 is a potent inhibitor of angiogenesis, and also shows antimicrobial activity[1][2]. CXCL14/BRAK Protein, Human is produced in E. coli, and consists of 77 amino acids (S35-E111).

Background

The chemokine CXCL14 is a highly conserved, homeostatic chemokine which is constitutively expressed in several normal tissues including adipose, brain, breast, cervix, lung, kidney, and skin. CXCL14 is involved in infectious and inflammatory diseases, angiogenesis, and cancer[1][2].
Among chemokines, CXCL14 is highly conserved in mammals with only two amino acids difference between mice and humans. CXCL14 has four conserved cysteine residues that form disulfide bonds7. Also, in common, the first 22 amino acids of the N-terminus are strongly hydrophobic and act as a signal peptide, which is cleaved prior to secretion. Like other chemokines, CXCL14 is a chemoattractant, especially for monocytes, and induces maturation and migration of dendritic cells (DCs). However, the CXCL14-related migration of monocyte in the absence of prostaglandin E2 (PGE2) is weak, showing that PGE2 is required for CXCL14-related chemotaxis. Responsiveness of monocytes to CXCL14 and PGE2 is specific, and B and T cells do not have any chemotactic response. In addition to monocytes, CXCL14 specifically increases chemotaxis of CD56+ natural killer (NK) cells. Responsible for immune cell recruitment and maturation, as well as impacting epithelial cell motility, CXCL14 contributes to the establishment of immune surveillance within normal epithelial layers. Overall, CXCL14 is responsible for the infiltration of immune cells, maturation of dendritic cells, upregulation of major histocompatibility complex (MHC)-I expression, and cell mobilization. Although fibroblast-derived CXCL14 has a tumor-supportive role, epithelial-derived CXCL14 mainly inhibits tumor progression[1][2].
Many previous studies on CXCL14 have shown contradictory functions of CXCL14: tumor suppression vs. promotion, increased vs. decreased cell migration, angiogenesis vs. angiostasis, and CXCR4 inhibition vs. activation vs. no effect. CXCL14 inhibits chemotaxis of endothelial cells by directly binding to IL-8 and FGF2, thus hindering their interaction with high-affinity receptors on human vascular endothelial cells. Moreover, CXCL14 broadly modulates chemotaxis, differentiation, and activation of various types of immune cells. Furthermore, CXCL14 also shows antimicrobial activity that effectively clears infection of Streptococcus pneumoniae in respiratory tracts[2].

In Vitro

Recombinant human CXCL14 (5-200 ng/mL) induced dendritic cell attraction in head and neck squamous cell carcinoma (HNSCC). CXCL14 resultes in up-regulation of the expression of dendritic cell maturation markers, as well as enhanced proliferation of allogeneic T cells in MLR. Activation of dendritic cell with recombinant human CXCL14 is accompanied by up-regulation of NF-κB activity[3].

Verified Bioactivity

Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is approximately 0.5965 ng/mL, corresponding to a specific activity is 1.676×106 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL14 (S35-E111)
      Accession # O95715
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL14; Kec; Prev. SCYB14; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 14 (BRAK); NJAC; Chemokine (C-X-C Motif) Ligand 14; Small-Inducible Cytokine B14; Breast And Kidney; C-X-C Motif Chemokine 14; MIP-2G; Chemokine BRAK; MIP2G; Bolekine; CXC

  • AA Sequence

    SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

  • Predicted Molecular Mass

    9.4 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 M NaCl, pH 8.5.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00