MIP-3 alpha/CCL20 Protein, Mouse

MIP-3 alpha/CCL20 Protein, Mouse is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse  is a recombinant mouse CCL20 (A28-M97) expressed by E. coli^[1].

CCL20, also known as macrophage inflammatory protein 3 alpha (MIP-3-alpha) and liver-activated regulatory chemokine (LARC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 2 in the human genome. It is expressed at lower levels in the thymus, testis, prostate and intestine. CCL20 binds to and acts as a chemokine receptor CCR6 and synergistically inhibits the function of CD8 T cells with CCR6. CCL20 has antimicrobial activity and has been implicated in autoimmune diseases such as inflammatory bowel disease, rheumatoid arthritis, and psoriasis, as well as oncological diseases. It can induce Tregs to invade tumor tissue, recruit dendritic cells to promote immunosuppression, and induce endothelial cell proliferation and neointima formation^[1][2].

CCL20 is preferentially released into the apical chamber in polarized BALB/c mouse uterine epithelial cells. In contrast, in rats, it is preferentially released into the basolateral compartment^[3].

CCL20 (s.c., 0.5 μg in 100 μL 1×PBS, every week, 21 days or 28 days) recruits a large number of GFP+ Treg cells to the tumor, and the tumor size of the mice is also significantly increased compared to the PBS control in B6.Cg-Foxp3 ^tm2Tch/J mice^[4].

1.Full biological activity determined by a chemotaxis bioassay using human CCR6 transfected murine BaF3 cells is in a concentration range of 0.1-10 ng/mL.
2.Measured by its ability to chemoattract Huh-7 cells. The ED₅₀ for this effect is 2-6 ng/mL.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR6. The ED₅₀ for this effect is 2-6 ng/mL.

• 
  Measured by its ability to chemoattract Huh-7 cells. The ED₅₀ for this effect is 4.218 ng/mL, corresponding to a specific activity is 2.37×10⁵ U/mg.

Mouse

E. coli

Tag Free

O89093 (A28-M97)

20297  [NCBI]

Full Length of Mature Protein

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Approximately 8-9 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Louis Boafo Kwantwi, et al. Multifaceted roles of CCL20 (C-C motif chemokine ligand 20): mechanisms and communication networks in breast cancer progression. Bioengineered. 2021 Dec;12(1):6923-6934.  [Content Brief]

  [2]. Skovdahl HK, et al. C-C Motif Ligand 20 (CCL20) and C-C Motif Chemokine Receptor 6 (CCR6) in Human Peripheral Blood Mononuclear Cells: Dysregulated in Ulcerative Colitis and a Potential Role for CCL20 in IL-1β Release. Int J Mol Sci. 2018 Oct 20;19(10).  [Content Brief]

  [3]. M Baba, et al. Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC. J Biol Chem. 1997 Jun 6;272(23):14893-8.  [Content Brief]

  [4]. Benkheil M, et al. CCL20, a direct-acting pro-angiogenic chemokine induced by hepatitis C virus (HCV): Potential role in HCV-related liver cancer. Exp Cell Res. 2018 Nov 15;372(2):168-177.  [Content Brief]

  [5]. Gisela Soboll, et al. Effect of oestradiol on PAMP-mediated CCL20/MIP-3 alpha production by mouse uterine epithelial cells in culture. Immunology. 2006 Jun;118(2):185-94.  [Content Brief]

  [6]. Jinlin Liu, et al. Tumor-associated macrophages recruit CCR6+ regulatory T cells and promote the development of colorectal cancer via enhancing CCL20 production in mice. PLoS One. 2011 Apr 29;6(4):e19495.  [Content Brief]