Copy Link Print Information

MIP-3 alpha/CCL20 Protein, Mouse

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

MIP-3 alpha/CCL20 Protein, Mouse is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse  is a recombinant mouse CCL20 (A28-M97) expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • MIP-3 alpha/CCL20 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MIP-3 alpha/CCL20 Protein, Mouse is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse  is a recombinant mouse CCL20 (A28-M97) expressed by E. coli[1].

Background

CCL20, also known as macrophage inflammatory protein 3 alpha (MIP-3-alpha) and liver-activated regulatory chemokine (LARC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 2 in the human genome. It is expressed at lower levels in the thymus, testis, prostate and intestine. CCL20 binds to and acts as a chemokine receptor CCR6 and synergistically inhibits the function of CD8 T cells with CCR6. CCL20 has antimicrobial activity and has been implicated in autoimmune diseases such as inflammatory bowel disease, rheumatoid arthritis, and psoriasis, as well as oncological diseases. It can induce Tregs to invade tumor tissue, recruit dendritic cells to promote immunosuppression, and induce endothelial cell proliferation and neointima formation[1][2].

In Vitro

CCL20 is preferentially released into the apical chamber in polarized BALB/c mouse uterine epithelial cells. In contrast, in rats, it is preferentially released into the basolateral compartment[3].

In Vivo

CCL20 (s.c., 0.5 μg in 100 μL 1×PBS, every week, 21 days or 28 days) recruits a large number of GFP+ Treg cells to the tumor, and the tumor size of the mice is also significantly increased compared to the PBS control in B6.Cg-Foxp3 tm2Tch/J mice[4].

Verified Bioactivity

1.Full biological activity determined by a chemotaxis bioassay using human CCR6 transfected murine BaF3 cells is in a concentration range of 0.1-10 ng/mL.
2.Measured by its ability to chemoattract Huh-7 cells. The ED50 for this effect is 2-6 ng/mL.
3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR6. The ED50 for this effect is 2-6 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    O89093 (A28-M97)

  • Gene ID
    20297  [NCBI]
  • Molecular Construction
    • N-term
    • CCL20 (A28-M97)
      Accession # O89093
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL20; Chemokine (C-C Motif) Ligand 20; Prev. SCYA20; C-C Motif Chemokine 20; LARC; CC Chemokine LARC; MIP-3a; MIP-3-Alpha; ST38; Exodus-1; CKb4; MIP3A; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 20; Beta Chemokine Exodus-1; Liver And Activati

  • AA Sequence

    ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

  • Predicted Molecular Mass

    8 kDa

  • Molecular Weight

    Approximately 8-9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Louis Boafo Kwantwi, et al. Multifaceted roles of CCL20 (C-C motif chemokine ligand 20): mechanisms and communication networks in breast cancer progression. Bioengineered. 2021 Dec;12(1):6923-6934. [Content Brief]

[2]. Skovdahl HK, et al. C-C Motif Ligand 20 (CCL20) and C-C Motif Chemokine Receptor 6 (CCR6) in Human Peripheral Blood Mononuclear Cells: Dysregulated in Ulcerative Colitis and a Potential Role for CCL20 in IL-1β Release. Int J Mol Sci. 2018 Oct 20;19(10). [Content Brief]

[3]. M Baba, et al. Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC. J Biol Chem. 1997 Jun 6;272(23):14893-8. [Content Brief]

[4]. Benkheil M, et al. CCL20, a direct-acting pro-angiogenic chemokine induced by hepatitis C virus (HCV): Potential role in HCV-related liver cancer. Exp Cell Res. 2018 Nov 15;372(2):168-177. [Content Brief]

[5]. Gisela Soboll, et al. Effect of oestradiol on PAMP-mediated CCL20/MIP-3 alpha production by mouse uterine epithelial cells in culture. Immunology. 2006 Jun;118(2):185-94. [Content Brief]

[6]. Jinlin Liu, et al. Tumor-associated macrophages recruit CCR6+ regulatory T cells and promote the development of colorectal cancer via enhancing CCL20 production in mice. PLoS One. 2011 Apr 29;6(4):e19495. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract Huh-7 cells. The ED50 for this effect is 4.218 ng/mL, corresponding to a specific activity is 2.37×105 U/mg.

  • 1/16

    MIP-3 alpha/CCL20 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Jan 15:361:123297. [Abstract]

    Customer Validation
     HL-60 cells were pretreated with MIP-3 alpha/CCL20 Protein, Mouse (1 μg/mL) for 30 min, followed by treatment with DNR (1.6, 3.2 μM) for 48 h, and cell viability was detected using the CCK-8 assay.

  • 1/16

    MIP-3 alpha/CCL20 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Jan 15:361:123297. [Abstract]

    Customer Validation
     HL-60 cells were treated with DNR (1.6, 3.2 μM) and MIP-3 alpha/CCL20 Protein, Mouse (1 μg/mL) for 24 hours. Total protein was extracted and the expression levels of IRP2, TFR1 and FTL were analyzed by Western blotting.

  • 1/16

    MIP-3 alpha/CCL20 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Jan 15:361:123297. [Abstract]

    Customer Validation
     HL-60 cells were pretreated with MIP-3 alpha/CCL20 Protein, Mouse (1 μg/mL) for 30 min, followed by treatment with DNR (1.6, 3.2 μM) for 48 h, and lipid peroxidation levels were measured.

  • MIP-3 alpha/CCL20 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • Experimental Validation Results for MIP-3 alpha/CCL20 Protein, Mouse
  • MIP-3 alpha/CCL20 Protein, Mouse Product Image

  • MIP-3 alpha/CCL20 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Jan 15:361:123297. [Abstract]

    HL-60 cells were pretreated with MIP-3 alpha/CCL20 Protein, Mouse (1 μg/mL) for 30 min, followed by treatment with DNR (1.6, 3.2 μM) for 48 h, and cell viability was detected using the CCK-8 assay.

  • MIP-3 alpha/CCL20 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Jan 15:361:123297. [Abstract]

    HL-60 cells were treated with DNR (1.6, 3.2 μM) and MIP-3 alpha/CCL20 Protein, Mouse (1 μg/mL) for 24 hours. Total protein was extracted and the expression levels of IRP2, TFR1 and FTL were analyzed by Western blotting.

  • MIP-3 alpha/CCL20 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Jan 15:361:123297. [Abstract]

    HL-60 cells were pretreated with MIP-3 alpha/CCL20 Protein, Mouse (1 μg/mL) for 30 min, followed by treatment with DNR (1.6, 3.2 μM) for 48 h, and lipid peroxidation levels were measured.