Eotaxin/CCL11 Protein, Mouse
Based on 1 Customer Validation
Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.
Background
CCL11 is a small cytokine belonging to the CC chemokine family. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergicresponses[1]. It is produced by IFN-γ-stimulated endothelial cells and TNF-activated monocytes. CCL11 is a potent chemoattractant for eosinophils, basophils, and Th2 lymphocytes. CCL11 has a number of important biological functions in disease processes. It plays a critical role in allergic and nonallergic inflammatory reactions, such as mycobacterial and schistosomal induced granulomatosis[2].
In Vivo
In CCL11-/- BALB/c mice, methylcholanthrene (MCA) at a concentration of 100 μg can induce fibrosarcoma in 90% of mice, possibly associated with a reduction in eosinophil influx into the tumor, which directly kills MCA-induced fibrosarcoma cells[2].
CCL11 expression is produced in the peritoneum, serum and lung and peaked after 4 h intraperitoneal injection of 500 μg lipopolysaccharide (LPS) in 1 mL saline in murine model of sublethal endotoxemia. When eotaxin/CCL11 knockout mice are treated with LPS, there is an increase in peritoneal neutrophils, but not lung neutrophils, compared to wild-type controls. CCL11-/- mice suppresses peritoneal neutrophils associated with endotoxemia[3].
Verified Bioactivity
1.Full biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/mL.
2.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 1-5 ng/mL.
3.Measured by its ability to chemoattract BaF3-CCR3 cells. The ED50 for this effect is 4.9-5.0 ng/mL, corresponding to a specific activity is 2.029×105 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P48298 (H24-P97)
-
Molecular Construction
-
N-term
-
CCL11 (H24-P97)
Accession # P48298 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL11; Eosinophil Chemotactic Protein; Prev. SCYA11; MGC22554; Eotaxin; Small-Inducible Cytokine A11; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 11 (Eotaxin); C-C Motif Chemokine 11; Chemokine (C-C Motif) Ligand 11; C-C Motif Chemokine; C-C Mo
-
AA Sequence
HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
-
Predicted Molecular Mass
8.4 kDa
-
Molecular Weight
Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Antonio L. Teixeira, et al. Revisiting the Role of Eotaxin-1/CCL11 in Psychiatric Disorders. Front Psychiatry. 2018 Jun 14;9:241. [Content Brief]
[2]. Garcia-Zepeda EA, et al. Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia. Nat Med. 1996 Apr;2(4):449-56. [Content Brief]
[3]. R Salcedo, et al. Eotaxin (CCL11) induces in vivo angiogenic responses by human CCR3+ endothelial cells. J Immunol. 2001 Jun 15;166(12):7571-8. [Content Brief]
[4]. Salcedo R, et al. Eotaxin (CCL11) induces in vivo angiogenic responses by human CCR3+ endothelial cells. J Immunol. 2001 Jun 15;166(12):7571-8. [Content Brief]
[5]. Ljubov Simson, et al. Regulation of carcinogenesis by IL-5 and CCL11: a potential role for eosinophils in tumor immune surveillance. J Immunol. 2007 Apr 1;178(7):4222-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)