Eotaxin/CCL11 Protein, Mouse

Customer Review

Based on 1 Customer Validation

Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.

Background

CCL11 is a small cytokine belonging to the CC chemokine family. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergicresponses[1]. It is produced by IFN-γ-stimulated endothelial cells and TNF-activated monocytes. CCL11 is a potent chemoattractant for eosinophils, basophils, and Th2 lymphocytes. CCL11 has a number of important biological functions in disease processes. It plays a critical role in allergic and nonallergic inflammatory reactions, such as mycobacterial and schistosomal induced granulomatosis[2].

In Vivo

In CCL11-/- BALB/c mice, methylcholanthrene (MCA) at a concentration of 100 μg can induce fibrosarcoma in 90% of mice, possibly associated with a reduction in eosinophil influx into the tumor, which directly kills MCA-induced fibrosarcoma cells[2].
       CCL11 expression is produced in the peritoneum, serum and lung and peaked after 4 h  intraperitoneal injection of 500 μg lipopolysaccharide (LPS) in 1 mL saline in murine model of sublethal endotoxemia. When eotaxin/CCL11 knockout mice are treated with LPS, there is an increase in peritoneal neutrophils, but not lung neutrophils, compared to wild-type controls. CCL11-/- mice suppresses peritoneal neutrophils associated with endotoxemia[3].

Verified Bioactivity

1.Full biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/mL.
2.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 1-5 ng/mL.
3.Measured by its ability to chemoattract BaF3-CCR3 cells. The ED50 for this effect is 4.9-5.0 ng/mL, corresponding to a specific activity is 2.029×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 1.804 ng/mL, corresponding to a specific activity is 5.543×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL11 (H24-P97)
      Accession # P48298
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL11; Eosinophil Chemotactic Protein; Prev. SCYA11; MGC22554; Eotaxin; Small-Inducible Cytokine A11; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 11 (Eotaxin); C-C Motif Chemokine 11; Chemokine (C-C Motif) Ligand 11; C-C Motif Chemokine; C-C Mo

  • AA Sequence

    HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

  • Predicted Molecular Mass

    8.4 kDa

  • Molecular Weight

    Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00