1802086-23-2
Chemical Structure
(Gly22)-Amyloid β-Protein (1-42)
- CAS No.: 1802086-23-2
- Formula:C200H307N55O58S
- Molecular Weight:4441.98
SMILES: [DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA]
Biological Activity: (Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22 to Gly22 in Aβ can increase aggregation[1][2].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
(Gly22)-Amyloid β-Protein (1-42) | (Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22 to Gly22 in Aβ can increase aggregation. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||
References
- [1]. Poduslo JF, et al. Receptor-mediated transport of human amyloid beta-protein 1-40 and 1-42 at the blood-brain barrier. Neurobiol Dis. 1999 Jun;6(3):190-9. [Content Brief]
- [2]. Xiaoling Lin, et al. Identification of novel oligopeptides from the simulated digestion of sea cucumber (Stichopus japonicus) to alleviate Aβ aggregation progression. Journal of Functional Foods. Volume 60, September 2019, 103412