country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10290

Copy Link Print Information

Neuropeptide Y (human) free acid

Neuropeptide Y (human) free acid is the deamidated form of Neuropeptide Y (human, rat, mouse) (HY-P0198). The amidation of Neuropeptide Y C-terminal tyrosine is critical for its function. Non-amidated Neuropeptide Y fails to elicit G protein signaling.

For research use only. We do not sell to patients.

CAS No.: 99575-89-0
Formula: C₁₈₉H₂₈₄N₅₄O₅₈S
Molecular Weight:4272.67

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Neuropeptide Y (human) free acid Chemical Structure

CAS No.: 99575-89-0

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

All Neuropeptide Y Receptor Isoforms :

Chemical Information

CAS No. 99575-89-0
Molecular Weight 4272.67
Formula C₁₈₉H₂₈₄N₅₄O₅₈S
Sequence

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
Sequence Shortening

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQ
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Cajado et al. Neuropeptide Y family-degrading metallopeptidases in the Tityus serrulatus venom partially blocked by commercial antivenoms. Toxicol Sci. 2014 Dec;142(2):418-26. [Content Brief]

[2]. Sung CP, et al. Neuropeptide Y upregulates the adhesiveness of human endothelial cells for leukocytes. Circ Res. 1991 Jan;68(1):314-8. [Content Brief]

[3]. Gordon EA, et al. Characterization of functional neuropeptide Y receptors in a human neuroblastoma cell line. J Neurochem. 1990 Aug;55(2):506-13. [Content Brief]

[4]. Chaehee Park, et al. Structural basis of neuropeptide Y signaling through Y1 receptor. Nat Commun. 2022 Feb 14;13(1):853. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote

Amount: USD 0.00

Biological Activity
- Description
Chemical Information
Purity & Documentation
References

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Product Name:
CAS No.:
Species:
Purity:
Quantity:

Neuropeptide Y (human) free acid

All Neuropeptide Y Receptor Isoforms