pH-Low Insertion Peptide TFA
Based on 1 Customer Validation
pH-Low Insertion Peptide TFA (pHLIP TFA) is a short, pH-responsive peptide capable of inserting across a cell membrane to form a transmembrane helix at acidic pH. pH-Low Insertion Peptide TFA targets the acidic tumor microenvironment for tumors at early and metastatic stages with high specificity, used as a specific ligand. pH-Low Insertion Peptide TFA successfully modifys polylysine polymers to have the pH-responsive capability. pH-Low Insertion Peptide TFA -based targeting of cancer presents an opportunity to monitor metabolic changes and to selectively deliver imaging and therapeutic agents to tumors.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity: 95.17%
- 화학식: C189H282N42O55S.xC2HF3O2
- 분자량:4054.57 (free base)
-
보관:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Biological Activity
pH-Low Insertion Peptide TFA (5 μM, 2 h) combined with peptide nucleic acid (peptide nucleic acid, PNA) significantly increases PNA delivery at pH 6.2 in A549 cells[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:A549 cells
-
Concentration:5 μM
-
Incubation Time:2 h
-
Result:Significantly increases PNA delivery combined with PNA at pH 6.2 in A549 cells.
pH-Low Insertion Peptide TFA (10 μM, i.v., a single dose for 24 h) can clearly differentiate between regions of primarily tumor cells and nonmalignant stromal tissues, also accumulates the hypoxia marker Pimonidazole (HY-105129A) and relates to the production of acidic glucose metabolites in MMTV-Py MT mice[2].
pH-Low Insertion Peptide TFA (0.2 μmol/kg, i.v., a single dose for 24 h) demonstrats excellent tumor targeting combined with PNA in mice seeded melanoma tumors[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Murine 4T1 xenograft model[2]
-
Dosage:50 μM
-
Administration:a single tail vein injection, tumors collected at 4, 24, and 48 h after administration
-
Result:The spatial distribution and the intensity profiles of all pHLIP TFAs in tumors were identical in murine 4T1 xenograft mode.
-
Animal Model:FVB/N-Tg(MMTV-PyVT)634Mul/J transgenic female mice developed palpable mammary tumors at 12-15 weeks of age[2]
-
Dosage:10 μM
-
Administration:i.v., a single dose for 24 h
-
Result:Clearly differentiated between regions of primarily tumor cells and nonmalignant stromal tissues.
-
Animal Model:6-week old C57BL/6 mice seeded melanoma tumors[3]
-
Dosage:0.2 μmol/kg
-
Administration:intravenously injected via the retro-orbital sinus, a single dose for 24 h
-
Result:All the pH-Low Insertion Peptide TFA-PNAs demonstrated excellent tumor targeting.
Chemical Information
-
Appearance Solid
-
분자량 4054.57 (free base)
-
화학식 C189H282N42O55S.xC2HF3O2
-
Color White to off-white
-
Synonyms
pHLIP TFA
-
Sequence
Ala-Cys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Thr
-
Sequence Shortening
ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
순도&문서
-
Data Sheet (284 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yushuang Wei, et al. pH-responsive pHLIP (pH low insertion peptide) nanoclusters of superparamagnetic iron oxide nanoparticles as a tumor-selective MRI contrast agent. Acta Biomater. 2017 Jun;55:194-203. [Content Brief]
[2]. Adochite RC, et al. Targeting breast tumors with pH (low) insertion peptides[J]. Mol Pharm. 2014 Aug 4;11(8):2896-905. [Content Brief]
[3]. Svoronos AA, et al. Tumor-Targeted, Cytoplasmic Delivery of Large, Polar Molecules Using a pH-Low Insertion Peptide TFA [J]. Mol Pharm. 2020 Feb 3;17(2):461-471. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)