1. Peptides
  2. Proadrenomedullin (45-92), human

Proadrenomedullin (45-92), human 

Cat. No.: HY-P1838
Handling Instructions

Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Proadrenomedullin (45-92), human Chemical Structure

Proadrenomedullin (45-92), human Chemical Structure

CAS No. : 166798-69-2

Size Stock
1 mg   Get quote  
5 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products[1][2].

Molecular Weight

5114.76

Formula

C₂₁₅H₃₅₉N₆₇O₇₃S₂

CAS No.

166798-69-2

Sequence

{Glu}{Leu}{Arg}{Met}{Ser}{Ser}{Ser}{Tyr}{Pro}{Thr}{Gly}{Leu}{Ala}{Asp}{Val}{Lys}{Ala}{Gly}{Pro}{Ala}{Gln}{Thr}{Leu}{Ile}{Arg}{Pro}{Gln}{Asp}{Met}{Lys}{Gly}{Ala}{Ser}{Arg}{Ser}{Pro}{Glu}{Asp}{Ser}{Ser}{Pro}{Asp}{Ala}{Ala}{Arg}{Ile}{Arg}{Val}

Sequence Shortening

ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Proadrenomedullin (45-92), human
Cat. No.:
HY-P1838
Quantity: