ABCB5 Protein, Human (Trx)
ABCB5, N-Trx Protein, Human is a plasma membrane-spanning protein that in humans is encoded by the ABCB5 gene. ABCB5 is an ABC transporter and P-glycoprotein family member principally expressed in physiological skin and human malignant melanoma.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ABCB5, N-Trx Protein, Human is a plasma membrane-spanning protein that in humans is encoded by the ABCB5 gene. ABCB5 is an ABC transporter and P-glycoprotein family member principally expressed in physiological skin and human malignant melanoma[1].
Background
ATP-binding cassette (ABC) transporters play a pivotal role in physiology and pathology. Expression of ABCB5α/β might possibly provide two novel molecular markers for differential diagnosis of melanomas and constitute potential molecular targets for therapy of melanomas[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Trx
-
Accession
Q2M3G0-4 (I586-V692)
-
Molecular Construction
-
N-term
-
Trx
-
ABCB5 (I586-V692)
Accession # Q2M3G0-4 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ABCB5; ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 5; ATP Binding Cassette Subfamily B Member 5; ATP-Binding Cassette Sub-Family B Member 5; P-Glycoprotein ABCB5; ATP-Binding Cassette Protein; ABCB5alpha; ABCB5 P-Gp; EST422562; ATP-Binding Casset
-
AA Sequence
IRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFV
-
Predicted Molecular Mass
29.4 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)