Activin A Protein, Human/Mouse/Rat (Hyperactive Mutant)
Activin A, a multifunctional cytokine, is a member of TGF-β superfamily. Activin A first binds to the type II activin receptors (ActIIRA or ActRIIB) on the member surface, and then recruits and phosphorylates type I activin receptors (ActRI). Activin A primarily signal through SMAD2/3 proteins to regulate a variety of functions, including inflammation, fibrosis, and tumorigenesis. Activin A Protein, Human/Mouse/Rat (Hyperactive Mutant) is produced in HEK293 cells.
- Species: Rat; Mouse; Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Activin A, a multifunctional cytokine, is a member of TGF-β superfamily. Activin A first binds to the type II activin receptors (ActIIRA or ActRIIB) on the member surface, and then recruits and phosphorylates type I activin receptors (ActRI). Activin A primarily signal through SMAD2/3 proteins to regulate a variety of functions, including inflammation, fibrosis, and tumorigenesis[1]. Activin A Protein, Human/Mouse/Rat (Hyperactive Mutant) is produced in HEK293 cells.
Background
Activin is a member of transforming growth factor-β (TGF-β) superfamily consisting of two inhibin β subunits linked by disulfide bonds. Activin A is expressed widely in various tissues and cells with strong bioactivities and is the mostly studied activin[1].
The sequence of amino acids in Activin A proteins from different species is very stable, which leads to the conclusion that in the process of evolution, Activin A has been only slightly altered, and that both in humans and in animals, its function is similar.
Activin exists in three basic molecular forms composed of two inhibin β subunits: activin A (βAβA), activin B (βBβB), and activin AB (βAβB). Activin A binds with high affinity to activin type II receptors, which recruit type I receptors and are necessary for the activation of Smad2/3 signaling. The phosphorylated ActRI activates Smad2 and Smad3, which form a complex with Smad4 to translocate to the nucleus. Activin and TGF-β share the same signaling pathway at the level of Smad2/3/4. Activin A exerts a variety of biological functions including regulation of hematopoietic cell proliferation, neuron differentiation, pituitary hormone secretion, and tissue repair. It is also involved in the process of many diseases, for example, inflammation, fibrosis and tumorigenesis[1][2].
Activin A has pro- and anti-tumorigenic functions depending on the tumor type. In breast, liver and colon cancers, activin signals were revealed to inhibit tumor cell growth. In addition, tumor tissues were revealed to express decreased levels of activin A or increased levels of activin antagonists or demonstrated the downregulation of activin receptors or Smad proteins. Moreover, its roles include embryonic differentiation, trophoblast invasion of the uterine wall in early pregnancy, and fetal/neonate brain protection in hypoxic conditions. Activin A also regulates bone formation and regeneration, enhances joint inflammation in rheumatoid arthritis, and triggers pathogenic mechanisms in the respiratory system[1][2].
Technical Parameters
-
Species Rat; Mouse; Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P08476 (G311-S426, F368A)
-
Gene ID3624
-
Molecular Construction
-
N-term
-
6*His
-
Activin A (S21-S426, F368A)
Accession # P08476 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
INHBA; Follicle-Stimulating Hormone-Releasing Protein; Inhibin Subunit Beta A; Erythroid Differentiation Factor; Inhibin Beta A Chain; Inhibin Beta A Subunit; Activin Beta-A Chain; FSH-Releasing Protein; Inhibin, Beta A (Activin A, Activin AB Alpha Polype
-
AA Sequence
GLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSAHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS
-
Molecular Weight
Approximately 14 kDa under reduced (R) conditions, 25 kDa under non reducing (N) conditions, based on SDS-PAGE.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)