ADAMTS14 Protein, Human (His)
ADAMTS14 Protein, Human (His) is the recombinant human-derived ADAMTS14 protein, expressed by E. coli, with N-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ADAMTS14 Protein, Human (His) is the recombinant human-derived ADAMTS14 protein, expressed by E. coli, with N-6*His tag.
ADAMTS14 exhibits aminoprocollagen type I processing activity in the absence of ADAMTS2. It appears to be synthesized as a latent enzyme that requires activation to display aminoprocollagen peptidase activity. Additionally, ADAMTS14 cleaves lysyl oxidase LOX at a site downstream of its propeptide cleavage site to produce a short LOX form.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8WXS8 (H253-W555)
-
Gene ID140766
-
Molecular Construction
-
N-term
-
6*His
-
ADAMTS14 (H253-W555)
Accession # Q8WXS8 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ADAMTS14; ADAM-TS 14; ADAM Metallopeptidase With Thrombospondin Type 1 Motif 14; ADAMTS-14; A Disintegrin-Like And Metalloprotease (Reprolysin Type) With Thrombospondin Type 1 Motif, 14; ADAM-TS14; A Disintegrin And Metalloproteinase With Thrombospondin M
-
AA Sequence
HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCIWKSPEQTYGQDGGW
-
Predicted Molecular Mass
40.2 kDa
-
Molecular Weight
Approximately 40.2 kDa,based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
