AG-2 Protein, Human (His)

AG-2 Protein, Human (His) is the recombinant human-derived AG-2 protein, expressed by E. coli, with C-His tag.

AG-2, encoding for Anterior Gradient 2, a member of the protein disulfide isomerase family, is anticipated to exhibit dystroglycan binding activity, epidermal growth factor receptor binding activity, and identical protein binding activity. This protein is implicated in diverse biological processes, including digestive tract morphogenesis, mucus secretion, and positive regulation of developmental growth. AG-2 is positioned in the endoplasmic reticulum and displays biased expression in various tissues, with notable prevalence in the large intestine and colon of adults. The orthologous relationship to the human AGR2 underscores its evolutionary conservation, suggesting shared functional roles and potential contributions to cellular and developmental processes.

Human EpCAM, hFc Tag captured on CM5 Chip via Protein A can bind Human AGR-2, His Tag , with an affinity constant of 6.91 μM as determined in SPR assay (Biacore T200).

Human

E. coli

C-8*His

NP_006399 (R21-L175)

10551

Full Length of Mature Protein

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Predicted band size: 18.77 kDa; Observed band size: 18.77 kDa.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 1 mM TCEP, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.