APEG1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

APEG1 Isoform 3 potentially regulates the growth and differentiation of arterial smooth muscle cells. APEG1 Protein, Human (His) is the recombinant human-derived APEG1 protein, expressed by E. coli , with C-His labeled tag.

Background

APEG1, specifically isoform 3, is implicated in the potential regulation of growth and differentiation processes in arterial smooth muscle cells.

Verified Bioactivity

When Recombinant Human APEG1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Anti- APEG1 Antibody, The ED50 for this effect is 8.941 μg/mL.

Assay Procedure

Materials
Biotin
Pre-chilled sterile water
Wash buffer: 1X PBST
Blocking buffer: 1% BSA in 1X PBST
TMB substrate solution: Mix substrate solution A and B at a 1:1 ratio immediately before use
Stop solution: 2 M H2SO4
APEG1 Protein, Human (His) (HY-P76729)

Procedure
1. Coating: Dilute Human APEG1 to 2 μg/mL in 1X PBST, add 100 μL/well, and incubate overnight at 2-8°C.
2. Washing: Wash the plate with wash buffer (260 μL/well) , once, and pat dry.
3. Blocking: Add 150 μL/well of blocking buffer, incubate at 25°C with shaking at 450 rpm for 4 hours.
4. Dilute the primary antibody to concentrations of 0, 0.005, 0.01, 0.05, 0.1, 0.5, 1, 5, 10, 20, 50, 100, and 250 μg/mL.
5. Add primary antibody: 100 μL/well. Incubate for 2 hours at 25°C, 450 rpm.
6. Wash plates: Wash plates with wash buffer, 260 μL/well. Wash five times, allowing each wash to stand for 1 minute, then blot dry.
7. Add secondary antibody: Dilute secondary antibody at a 1:2000 ratio. Add 100 μL per well and incubate at 25°C, 450 rpm for 1 hour.
8. Washing: Wash the plate with wash buffer (260 μL/well) , three times, with each wash lasting 1 minute, then pat dry.
9. Add TMB Substrate Solution: Add 100 μL/well, incubate at room temperature in the dark for 15 minutes.
10. Stop Reaction: Add 100 μL of 2 M H2SO4 per well.
11. Read Plate: Measure absorbance at 450 nm.
12. Using GraphPad Prism software, plot a curve with the OD value as the vertical axis and the Anti-APEG1 Antibody concentration as the horizontal axis, and calculate the ED50 value.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • APEG1 (M1-E113)
      Accession # Q15772-4
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-4

  • Synonyms

    SPEG; Aortic Preferentially Expressed Protein 1; Prev. APEG1; SPEG Complex Locus; Striated Muscle Preferentially Expressed Protein Kinase; MGC12676; SPEGalpha; APEG-1; KIAA1297; Nuclear Protein, Marker For Differentiated Aortic Smooth Muscle And Down-Regu

  • AA Sequence

    MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

  • Predicted Molecular Mass

    12.7 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00