ASPH Protein, Human (His-SUMO)
ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag.
Background
CDC25 also phosphorylates a protein called SPRTN, promoting its recruitment to chromatin. It reduces replication stress and activates the G2/M checkpoint by phosphorylating and inactivating PABIR1/FAM122A. This promotes the serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
Q12797-6 (F75-T270)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
ASPH (F75-T270)
Accession # Q12797-6 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ASPH; Junctin; Aspartate Beta-Hydroxylase; Humbug; BAH; Aspartate Beta-Hydroxylase Isoform F; CASQ2BP1; Alternative Protein ASPH; JCTN; Cardiac Junctin; HAAH; A Beta H-J-J; Aspartyl/Asparaginyl Beta-Hydroxylase; ASPH Protein; Peptide-Aspartate Beta-Dioxyg
-
AA Sequence
FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT
-
Predicted Molecular Mass
38.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
