ASPH Protein, Human (His-SUMO)

ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag.

Background

CDC25 also phosphorylates a protein called SPRTN, promoting its recruitment to chromatin. It reduces replication stress and activates the G2/M checkpoint by phosphorylating and inactivating PABIR1/FAM122A. This promotes the serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • ASPH (F75-T270)
      Accession # Q12797-6
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ASPH; Junctin; Aspartate Beta-Hydroxylase; Humbug; BAH; Aspartate Beta-Hydroxylase Isoform F; CASQ2BP1; Alternative Protein ASPH; JCTN; Cardiac Junctin; HAAH; A Beta H-J-J; Aspartyl/Asparaginyl Beta-Hydroxylase; ASPH Protein; Peptide-Aspartate Beta-Dioxyg

  • AA Sequence

    FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

  • Predicted Molecular Mass

    38.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00