BD-1 Protein, Human
Based on 1 Customer Validation
BD-1 Protein, Human is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
BD-1 Protein, Human is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.
Recombinant Human Beta Defensin-1 is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts[1]. Human Beta Defensin-1 may provide a fast-acting antimicrobial coating of tubular lumens in the upper urinary tract to prevent infection by inhibiting bacterial attachment to the urothelium and serving as a second-line chemical shield[2].
Full biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100-1000 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P60022 (G22-K68)
-
Molecular Construction
-
N-term
-
BD-1 (G22-K68)
Accession # P60022 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rHuBD-1; HBD1; DEFB1
-
AA Sequence
GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
-
Predicted Molecular Mass
5.1 kDa
-
Molecular Weight
Approximately 6 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized after extensive dialysis against 20 mM PBS, pH 7.4, 130 mM NaCl.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Valore EV, et al. Human beta-defensin-1: an antimicrobial peptide of urogenital tissues. J Clin Invest. 1998 Apr 15;101(8):1633-42. [Content Brief]
[2]. Becknell B, et al. Expression and antimicrobial function of beta-defensin 1 in the lower urinary tract. PLoS One. 2013 Oct 21;8(10):e77714. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
