BD-3 Protein, Mouse
Based on 1 Customer Validation
BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.
Recombinant Mouse Beta Defensin-3 peptide, produced from a baculovirus expression system, shows antimicrobial activity against P. aeruginosa PAO1 (MIC of 8 μg/mL) and Escherichia coli D31 (MIC of 16 μg/mL) in a salt-dependent manner[1]. Mouse Beta Defensin-3 peptide exhibits broad-spectrum antimicrobial activity, this peptide may serve as an innate defense against microbial invasion at specific mucosal surfaces in the mouse[2].
Measured by its anti-microbial activity against E. coli. The ED50 this effect is 387.3 ng/mL, corresponding to a specific activity is 2.58×10^3 U/mg.
-
Measured by its anti-microbial activity against E. coli. The ED50 for this effect is 387.3 ng/mL, corresponding to a specific activity is 2.58×103 U/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9WTL0 (K23-K63)
-
Molecular Construction
-
N-term
-
BD-3 (K23-K63)
Accession # Q9WTL0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rMuBD-3; DEFB-3; HBD3; Beta-defensin 103
-
AA Sequence
KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 40 mM PB, 300 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Bals R, et al. Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in the epithelia of multiple organs. Infect Immun. 1999 Jul;67(7):3542-7. [Content Brief]
[2]. Burd RS, et al. Murine beta-defensin-3 is an inducible peptide with limited tissue expression and broad-spectrum antimicrobial activity. Shock. 2002 Nov;18(5):461-4. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
