BD-3 Protein, Mouse

BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.

Recombinant Mouse Beta Defensin-3 peptide, produced from a baculovirus expression system, shows antimicrobial activity against P. aeruginosa PAO1 (MIC of 8 μg/mL) and Escherichia coli D31 (MIC of 16 μg/mL) in a salt-dependent manner^[1]. Mouse Beta Defensin-3 peptide exhibits broad-spectrum antimicrobial activity, this peptide may serve as an innate defense against microbial invasion at specific mucosal surfaces in the mouse^[2].

Measured by its anti-microbial activity against E. coli. The ED₅₀ this effect is 387.3 ng/mL, corresponding to a specific activity is 2.58×10^3 U/mg.

• 
  Measured by its anti-microbial activity against E. coli. The ED₅₀ for this effect is 387.3 ng/mL, corresponding to a specific activity is 2.58×10³ U/mg.

Mouse

E. coli

Tag Free

Q9WTL0 (K23-K63)

27358  [NCBI]

Full Length of Mature Protein

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Approximately 10.06 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 40 mM PB, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Bals R, et al. Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in the epithelia of multiple organs. Infect Immun. 1999 Jul;67(7):3542-7.  [Content Brief]

  [2]. Burd RS, et al. Murine beta-defensin-3 is an inducible peptide with limited tissue expression and broad-spectrum antimicrobial activity. Shock. 2002 Nov;18(5):461-4.  [Content Brief]