BLNK Protein, Human (His)

BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Human
  • Source: E. coli
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Referencias
  • Help & FAQs

Actividad biológica

Descripciòn

BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors[1].

Background

B-cell linker protein (BLNK), also known as SLP-65, BASH and BCA, is a B-cell adaptor molecule that links the cytoplasmic protein tyrosine kinases (PTKs) with phosphorylation of downstream effector molecules and plays a crucial role in the BCR signalling system[2].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BLNK (M1-S456)
      Accession # AAH18906
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    BLNK; Bca; B Cell Linker; Src Homology [SH2] Domain-Containing Leukocyte Protein Of 65 KD; SLP65; Src Homology 2 Domain-Containing Leukocyte Protein Of 65 KDa; BASH; B-Cell Adapter Containing A Src Homology 2 Domain Protein; SLP-65; B Cell Adaptor Contain

  • AA Sequence

    MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS

  • Predicted Molecular Mass

    51.5 kDa

  • Peso molecular

    Approximately 40-80 kDa, based on SDS-PAGE under reducing conditions.

  • Pureza

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Referencias

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00