BLNK Protein, Human (His)
BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors[1].
B-cell linker protein (BLNK), also known as SLP-65, BASH and BCA, is a B-cell adaptor molecule that links the cytoplasmic protein tyrosine kinases (PTKs) with phosphorylation of downstream effector molecules and plays a crucial role in the BCR signalling system[2].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
AAH18906 (M1-S456)
-
Molecular Construction
-
N-term
-
BLNK (M1-S456)
Accession # AAH18906 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
BLNK; Bca; B Cell Linker; Src Homology [SH2] Domain-Containing Leukocyte Protein Of 65 KD; SLP65; Src Homology 2 Domain-Containing Leukocyte Protein Of 65 KDa; BASH; B-Cell Adapter Containing A Src Homology 2 Domain Protein; SLP-65; B Cell Adaptor Contain
-
AA Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
-
Predicted Molecular Mass
51.5 kDa
-
Molecular Weight
Approximately 40-80 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Soini L, et al. A biophysical and structural analysis of the interaction of BLNK with 14-3-3 proteins. J Struct Biol. 2020;212(3):107662. [Content Brief]
[2]. Taguchi T, et al. Deficiency of BLNK hampers PLC-gamma2 phosphorylation and Ca2+ influx induced by the pre-B-cell receptor in human pre-B cells. Immunology. 2004;112(4):575-582. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)