1. Recombinant Proteins
  2. Others
  3. BOLA1 Protein, Human (His)

The BOLA1 protein plays a critical role in assembling mitochondrial iron-sulfur (Fe-S) clusters and promoting their insertion into specific mitochondrial proteins. It may cooperate with the monothiol glutaredoxin GLRX5 in this process, underscoring its role in mitochondrial Fe-S cluster biogenesis. BOLA1 Protein, Human (His) is the recombinant human-derived BOLA1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BOLA1 protein plays a critical role in assembling mitochondrial iron-sulfur (Fe-S) clusters and promoting their insertion into specific mitochondrial proteins. It may cooperate with the monothiol glutaredoxin GLRX5 in this process, underscoring its role in mitochondrial Fe-S cluster biogenesis. BOLA1 Protein, Human (His) is the recombinant human-derived BOLA1 protein, expressed by E. coli , with N-His labeled tag.

Background

BOLA1 Protein functions as a crucial factor in the assembly of mitochondrial iron-sulfur (Fe-S) clusters, aiding in the insertion of these clusters into specific mitochondrial proteins. It likely collaborates with the monothiol glutaredoxin GLRX5 in this process, emphasizing its role in mitochondrial Fe-S cluster biogenesis. Additionally, BOLA1 may contribute to cellular defense against oxidative stress. Its interaction with GLRX5 further underscores its involvement in intricate molecular mechanisms, highlighting potential connections between mitochondrial iron homeostasis and cellular responses to oxidative challenges.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9Y3E2 (M1-P137)

Gene ID
Molecular Construction
N-term
His
BOLA1 (M1-P137)
Accession # Q9Y3E2
C-term
Protein Length

Full Length

Synonyms
BolA-like protein 1; hBolA; BOLA1; CGI-143
AA Sequence

MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Predicted Molecular Mass
16.4 kDa
Molecular Weight

Approximately 10 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BOLA1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BOLA1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BOLA1 Protein, Human (His)
Cat. No.:
HY-P75596
Quantity:
MCE Japan Authorized Agent: