BOLA1 Protein, Human (His)
The BOLA1 protein plays a critical role in assembling mitochondrial iron-sulfur (Fe-S) clusters and promoting their insertion into specific mitochondrial proteins. It may cooperate with the monothiol glutaredoxin GLRX5 in this process, underscoring its role in mitochondrial Fe-S cluster biogenesis. BOLA1 Protein, Human (His) is the recombinant human-derived BOLA1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The BOLA1 protein plays a critical role in assembling mitochondrial iron-sulfur (Fe-S) clusters and promoting their insertion into specific mitochondrial proteins. It may cooperate with the monothiol glutaredoxin GLRX5 in this process, underscoring its role in mitochondrial Fe-S cluster biogenesis. BOLA1 Protein, Human (His) is the recombinant human-derived BOLA1 protein, expressed by E. coli , with N-His labeled tag.
BOLA1 Protein functions as a crucial factor in the assembly of mitochondrial iron-sulfur (Fe-S) clusters, aiding in the insertion of these clusters into specific mitochondrial proteins. It likely collaborates with the monothiol glutaredoxin GLRX5 in this process, emphasizing its role in mitochondrial Fe-S cluster biogenesis. Additionally, BOLA1 may contribute to cellular defense against oxidative stress. Its interaction with GLRX5 further underscores its involvement in intricate molecular mechanisms, highlighting potential connections between mitochondrial iron homeostasis and cellular responses to oxidative challenges.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9Y3E2 (M1-P137)
-
Molecular Construction
-
N-term
-
His
-
BOLA1 (M1-P137)
Accession # Q9Y3E2 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
BOLA1; BolA-Like 1 (E. Coli); BolA Family Member 1; BolA Homolog 1; CGI-143; BolA-Like 1; BolA-Like Protein 1; HBolA; BolA Homolog 1 (E. Coli)
-
AA Sequence
MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
-
Predicted Molecular Mass
16.4 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
