CACNA2D1 Protein, Human (His-SUMO)
The CACNA2D1 protein, particularly its α-2/δ subunit, plays a key role in regulating calcium current density and activation/deactivation kinetics of voltage-dependent calcium channels. It contributes to excitation-contraction coupling, coordinating cellular processes. CACNA2D1 Protein, Human (His-SUMO) is the recombinant human-derived CACNA2D1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Speicherung:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Biologische Aktivität
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biologische Aktivität
The CACNA2D1 protein, particularly its α-2/δ subunit, plays a key role in regulating calcium current density and activation/deactivation kinetics of voltage-dependent calcium channels. It contributes to excitation-contraction coupling, coordinating cellular processes. CACNA2D1 Protein, Human (His-SUMO) is the recombinant human-derived CACNA2D1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
The CACNA2D1 protein, specifically its alpha-2/delta subunit, assumes a pivotal role in the regulation of calcium current density and the activation/inactivation kinetics of voltage-dependent calcium channels. It plays a crucial part in excitation-contraction coupling, contributing to the coordination of cellular processes. The alpha-2/delta subunit forms a dimer with alpha-2-1 and delta-1 chains through disulfide linkage, constituting an essential structural component of voltage-dependent calcium channels. These channels are intricate multisubunit complexes, composed of alpha-1 (CACNA1), alpha-2 (CACNA2D), beta (CACNB), and delta (CACNA2D) subunits in a 1:1:1:1 ratio. The functional and structural involvement of CACNA2D1 underscores its significance in the precise modulation of calcium signaling and cellular responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P54289 (Q528-N668)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CACNA2D1 (Q528-N668)
Accession # P54289 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CA2D1_HUMAN; CACN A2; CACNA2; Cacna2d1; CACNL2A; Calcium channel L type alpha 2 polypeptide; Calcium channel voltage dependent alpha 2/delta subunit 1; CCHL2A; Dihydropyridine receptor alpha 2 subunit; Dihydropyridine sensitive L type calcium channel alpha 2/delta subunit; Dihydropyridine sensitive L type calcium channel subunits alpha 2/delta; L type calcium channel subunit alpha 2; MHS 3; MHS3; Voltage dependent calcium channel subunit alpha 2/delta 1; Voltage gated calcium channel subunit alpha 2/delta 1; Voltage-dependent calcium channel subunit delta-1; Voltage-gated calcium channel subunit alpha-2/delta-1
-
AA Sequence
QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
-
Predicted Molecular Mass
32.3 kDa
-
Reinheit
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm solution of Tris-based buffer, 50% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Powered by Bioz
