Cationic trypsin Protein, Dog (His-SUMO)
Based on 1 Customer Validation
Cationic trypsin Protein, Dog (His-SUMO) is the recombinant dog-derived Cationic trypsin protein, expressed by E. coli, with N-His, N-SUMO labeled tag.
- Species: Dog
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cationic trypsin Protein, Dog (His-SUMO) is the recombinant dog-derived Cationic trypsin protein, expressed by E. coli, with N-His, N-SUMO labeled tag.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Dog
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P06871 (I24-N246)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
PRSS1 (I24-N246)
Accession # P06871 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRSS1; TRP1; Prev. TRY1; Anionic Trypsin-I; Cationic Trypsinogen; Protease Serine 1; Nonfunctional Trypsin 1; TCR V Beta 4.1; Protease, Serine 1; Trypsinogen A; Anionic Trypsin I; Trypsinogen 1; Pretrypsinogen I; Trypsin 1; Beta-Trypsin; Trypsin-1; Trypsi
-
AA Sequence
IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN
-
Predicted Molecular Mass
39.6 kDa
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
