CD150/SLAMF1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV).
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV)[1][2].
Signaling lymphocyte activation molecule (SLAM), also known as CD150, is the member of the CD2 protein family of immunoglobulin (Ig) domain-containing molecules and are expressed on the surface of a wide variety of hematopoietic cells. SLAM family members are now recognized as important immunomodulatory receptors with roles in cytotoxicity, humoral immunity, autoimmunity, cell survival, lymphocyte development, and cell adhesion. SLAM can act as a cellular receptor for both vaccine and wild-type strains of MV[1][2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q13291-1 (A21-P237)
-
Molecular Construction
-
N-term
-
SLAMF1 (A21-P237)
Accession # Q13291-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SLAMF1; IPO-3; Prev. SLAM; CDw150; Signaling Lymphocytic Activation Molecule; IPO3; CD150; CD150 Antigen; Signaling Lymphocytic Activation Molecule Family Member 1; SLAM Family Member 1
-
AA Sequence
ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP
-
Predicted Molecular Mass
25.3 kDa
-
Molecular Weight
Approximately 38-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705. [Content Brief]
[2]. Hashimoto K, et, al. SLAM (CD150)-independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76(13):6743-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
