CD150/SLAMF1 Protein, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV)^[1][2].

Signaling lymphocyte activation molecule (SLAM), also known as CD150, is the member of the CD2 protein family of immunoglobulin (Ig) domain-containing molecules and are expressed on the surface of a wide variety of hematopoietic cells. SLAM family members are now recognized as important immunomodulatory receptors with roles in cytotoxicity, humoral immunity, autoimmunity, cell survival, lymphocyte development, and cell adhesion. SLAM can act as a cellular receptor for both vaccine and wild-type strains of MV^[1][2].

Human

HEK293

C-6*His

Q13291 (A21-P237)

6504  [NCBI]

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

38-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.  [Content Brief]

  [2]. Hashimoto K, et, al. SLAM (CD150)-independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76(13):6743-9.  [Content Brief]