CD43 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Human (HEK293, His) is the recombinant human-derived CD43 protein, expressed by HEK293 , with C-8*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Human (HEK293, His) is the recombinant human-derived CD43 protein, expressed by HEK293 , with C-8*His labeled tag.
Background
The CD43 protein stands out as the predominant cell surface sialoprotein of leukocytes, orchestrating a myriad of crucial functions in T-cell regulation. It exerts a positive influence on T-cell activation, proliferation, differentiation, trafficking, and migration, notably facilitating T-cell trafficking to lymph nodes through its association with ERM proteins (EZR, RDX, and MSN). While playing a role in preparing T-cells for cytokine sensing and differentiation into effector cells, CD43 negatively regulates Th2 cell differentiation and steers T-cells toward a Th1 lineage commitment. Additionally, it plays a pivotal role in inducing the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation, promoting IFNGR and IL4R signaling, and mediating the clustering of IFNGR with TCR. Acting as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 serves as a T-cell counter-receptor for SIGLEC1, contributing to cell survival by protecting cells from apoptotic signals.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
P16150 (S20-R253)
-
Molecular Construction
-
N-term
-
CD43 (S20-R253)
Accession # P16150 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SPN; LSN; Sialophorin; Sialophorin (GpL115, Leukosialin, CD43); GPL115; Leukocyte Sialoglycoprotein; CD43; Galactoglycoprotein; Leukosialin; GALGP; LEU-22; CD43 Antigen
-
AA Sequence
STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR
-
Predicted Molecular Mass
24.5 kDa
-
Molecular Weight
Approximately 45-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)