CD69 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Human (HEK293, His) is the recombinant human-derived CD69 protein, expressed by HEK293 , with N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Human (HEK293, His) is the recombinant human-derived CD69 protein, expressed by HEK293 , with N-8*His labeled tag.

Background

The CD69 protein plays a pivotal role in lymphocyte proliferation, serving as a signal-transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. Structurally, it forms homodimers linked by disulfide bonds, emphasizing its involvement in cellular signaling processes crucial for immune responses and platelet function.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • CD69 (G64-K199)
      Accession # Q07108
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD69; AIM; CD69 Molecule; EA1; CLEC2C; CDNA FLJ75888, Highly Similar To Homo Sapiens CD69 Antigen (P60, Early T-Cell Activation Antigen) (CD69), MRNA; CD69 Antigen (P60, Early T-Cell Activation Antigen); CDNA FLJ55409, Highly Similar To Early Activation A

  • AA Sequence

    GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

  • Predicted Molecular Mass

    16.9 kDa

  • Molecular Weight

    Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00