Copy Link Print Information

CD74 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD74 Protein, Human (HEK293, His)
  • CD74 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Background

The CD74 Protein plays a crucial role as an associate of class II major histocompatibility complex (MHC), functioning as a vital chaperone in the regulation of antigen presentation for immune response. Additionally, it serves as a cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation upon binding. Notably, CD74 interacts with amyloid precursor protein (APP) and acts to suppress the production of amyloid beta (Abeta), implicating its potential role in neuroprotective mechanisms. The gene exhibits broad expression, with significant levels detected in spleen (RPKM 1835.3), lymph node (RPKM 1421.7), and 24 other tissues, highlighting its involvement in diverse immune and cellular processes across various organs.

Verified Bioactivity

1. Immobilized Human CD74 at 0.5 μg/mL(100 μL/Well) on the plate. Dose response curve for Anti-CD74 Antibody, hFc Tag with the EC50 of 8.9 ng/mL determined by ELISA.
2.Immobilized Human CD74 at 1 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-CD74 Antibody, hFc Tag with the EC50 of 3.1 ng/mL determined by ELISA.
3. Loaded Bezetabart (HY-P990728) on AHC2 biosensor, can bind CD74 Protein, Human (HEK293, His) with an affinity constant of 6.944E-10 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His
  • Accession

    NP_004346.1 (Q73-M232)

  • Gene ID
    972  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • CD74 (Q73-M232)
      Accession # NP_004346.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD74; Ia-Associated Invariant Chain; Prev. DHLAG; HLA-DR-Gamma; CLIP; Ia Antigen-Associated Invariant Chain; CD74 Antigen (Invariant Polypeptide Of Major Histocompatibility Complex, Class II Antigen-Associated); CD74 Antigen; CD74 Molecule, Major Histocom

  • AA Sequence

    QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

  • Predicted Molecular Mass

    19.1 kDa

  • Molecular Weight

    Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Loaded Bezetabart (HY-P990728) on AHC2 biosensor, can bind CD74 Protein, Human (HEK293, His) with an affinity constant of 6.944E-10 M as determined in BLI assay.

  • CD74 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD74 Protein, Human (HEK293, His)
  • CD74 Protein, Human (HEK293, His) Product Image