CD81 Protein, Rat (HEK293)
CD81, a versatile protein, participates in complement-opsonized particle ingestion, inhibits osteoclast formation, and regulates compartmentalized enzymatic activities. In T cells, CD81 controls intracellular dNTP levels by localizing and degrading SAMHD1. Moreover, it influences cell adhesion and motility, notably in macrophages. CD81 Protein, Rat (HEK293) is the recombinant rat-derived CD81 protein, expressed by HEK293 , with tag free.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD81, a versatile protein, participates in complement-opsonized particle ingestion, inhibits osteoclast formation, and regulates compartmentalized enzymatic activities. In T cells, CD81 controls intracellular dNTP levels by localizing and degrading SAMHD1. Moreover, it influences cell adhesion and motility, notably in macrophages. CD81 Protein, Rat (HEK293) is the recombinant rat-derived CD81 protein, expressed by HEK293 , with tag free.
Background
CD81 is a protein involved in various cellular processes. It plays a role in complement-opsonized particle ingestion, prevents the formation of osteoclasts responsible for bone resorption, and regulates enzymatic activities within cellular compartments. In T cells, CD81 helps control intracellular dNTP levels by localizing and degrading the protein SAMHD1. It is also involved in cell adhesion and motility, particularly in macrophages.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag Tag Free
-
Accession
Q62745 (K116-K201)
-
Molecular Construction
-
N-term
-
CD81 (K116-K201)
Accession # Q62745 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD81; CD81 Antigen (Target Of Antiproliferative Antibody 1); Prev. TAPA1; Tspan-28; TSPAN28; TAPA-1; Tetraspanin-28; Target Of The Antiproliferative Antibody 1; CD81 Antigen; Tetraspanin; S5.7; CVID6; CD81 Molecule; 26 KDa Cell Surface Protein TAPA-1
-
AA Sequence
KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNTLTTLTTAVLRNSLCPSSSNSFTQLLKEDCHQKIDELFSGK
-
Predicted Molecular Mass
9.7 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)