1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TAPA-1/CD81
  5. CD81 Protein, Rat (HEK293)

CD81, a versatile protein, participates in complement-opsonized particle ingestion, inhibits osteoclast formation, and regulates compartmentalized enzymatic activities. In T cells, CD81 controls intracellular dNTP levels by localizing and degrading SAMHD1. Moreover, it influences cell adhesion and motility, notably in macrophages. CD81 Protein, Rat (HEK293) is the recombinant rat-derived CD81 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD81, a versatile protein, participates in complement-opsonized particle ingestion, inhibits osteoclast formation, and regulates compartmentalized enzymatic activities. In T cells, CD81 controls intracellular dNTP levels by localizing and degrading SAMHD1. Moreover, it influences cell adhesion and motility, notably in macrophages. CD81 Protein, Rat (HEK293) is the recombinant rat-derived CD81 protein, expressed by HEK293 , with tag free.

Background

CD81 is a protein involved in various cellular processes. It plays a role in complement-opsonized particle ingestion, prevents the formation of osteoclasts responsible for bone resorption, and regulates enzymatic activities within cellular compartments. In T cells, CD81 helps control intracellular dNTP levels by localizing and degrading the protein SAMHD1. It is also involved in cell adhesion and motility, particularly in macrophages.

Species

Rat

Source

HEK293

Tag

Tag Free

Accession

Q62745 (K116-K201)

Gene ID
Molecular Construction
N-term
CD81 (K116-K201)
Accession # Q62745
C-term
Protein Length

Partial

Synonyms
CD81 antigen; CD81; CVID6; TAPA-1; TSPAN28
AA Sequence

KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNTLTTLTTAVLRNSLCPSSSNSFTQLLKEDCHQKIDELFSGK

Predicted Molecular Mass
9.7 kDa
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD81 Protein, Rat (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD81 Protein, Rat (HEK293)
Cat. No.:
HY-P75379
Quantity:
MCE Japan Authorized Agent: