1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins B Cell CD Proteins Dendritic Cell CD Proteins
  4. CD83
  5. CD83 Protein, Mouse (HEK293, His)

CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD83 protein emerges as a potential key player in antigen presentation or the subsequent cellular interactions that occur following lymphocyte activation, underscoring its significance in immune processes. Its involvement suggests a potential role in orchestrating the presentation of antigens, a crucial step in immune recognition and response. Structurally, CD83 functions as a monomer, indicating its singular molecular form in executing its biological activities. Further exploration into the specific mechanisms by which CD83 participates in antigen presentation and lymphocyte activation could provide valuable insights into its pivotal role in shaping immune responses and cellular interactions within the immune system.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

O88324 (M22-A134)

Gene ID
Molecular Construction
N-term
CD83 (M22-A134)
Accession # O88324
His
C-term
Protein Length

Extracellular Domain

Synonyms
B-cell activation protein; CD83 antigen; hCD83; CD83; BL11
AA Sequence

MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA

Predicted Molecular Mass
13.4 kDa
Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD83 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD83 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74260
Quantity:
MCE Japan Authorized Agent: