CD99L2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag.
Background
The CD99L2 protein plays a vital role in facilitating a late step of leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane barrier. It acts at the same site as PECAM1, although independently, to promote this process. CD99L2 functions as a homophilic adhesion molecule, although its interactions may not be necessary for cell aggregation.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD99L2 is coated at 2 µg/mL (100 µL/well) can blind Recombinant Mouse CD99L2. The ED50 for this effect is 1.762 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q8BIF0-1 (D26-A164)
-
Molecular Construction
-
N-term
-
CD99L2 (D26-A164)
Accession # Q8BIF0 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD99L2; MIC2-Like Protein 1; Prev. MIC2L1; CD99 Molecule-Like 2; CD99 Antigen-Like Protein 2; CD99 Antigen-Like 2; CD99B; CD99 Antigen; CD99 Molecule Like 2; MIC2 Like 1
-
AA Sequence
DTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIA
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
