CDK9 Protein, Human (sf9, GST)

Customer Review

Based on 1 Customer Validation

The CDK9 protein plays a central role in transcriptional regulation, promoting the transition from ineffective to efficient elongation by phosphorylating POLR2A, SUPT5H, and RDBP. As part of the CDK9/cyclin-T complex, it participates in phosphorylation events affecting EP300, MYOD1, RPB1/POLR2A, AR, DSIF, and NELFE. CDK9 Protein, Human (Sf9, GST) is the recombinant human-derived CDK9, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK9 Protein, Human (Sf9, GST) is 372 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CDK9 protein plays a central role in transcriptional regulation, promoting the transition from ineffective to efficient elongation by phosphorylating POLR2A, SUPT5H, and RDBP. As part of the CDK9/cyclin-T complex, it participates in phosphorylation events affecting EP300, MYOD1, RPB1/POLR2A, AR, DSIF, and NELFE. CDK9 Protein, Human (Sf9, GST) is the recombinant human-derived CDK9, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK9 Protein, Human (Sf9, GST) is 372 a.a..

Background

The CDK9ic protein emerges as a central player in the intricate regulation of transcription, orchestrating a diverse range of cellular processes. As a pivotal member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also known as positive transcription elongation factor b (P-TEFb), it facilitates the transition from abortive to productive elongation by phosphorylating the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), SUPT5H, and RDBP. This complex, inactive in the 7SK small nuclear ribonucleoprotein (snRNP) complex form, engages in phosphorylation events targeting EP300, MYOD1, RPB1/POLR2A, AR, and the negative elongation factors DSIF and NELFE. Beyond its role in transcription, CDK9-CCNK regulates cytokine-inducible transcription networks, promoting RNA synthesis in genetic programs for cell growth, differentiation, and viral pathogenesis. The complex also plays a critical role in cotranscriptional histone modification, mRNA processing, mRNA export, and a network of chromatin modifications. Moreover, it contributes to genome integrity maintenance, replication stress response, and cardiac myocyte enlargement. The multifaceted activities of CDK9-CCNK underscore its significance in governing diverse cellular functions and molecular pathways.

Verified Bioactivity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CDK9; Tat-Associated Kinase Complex Catalytic Subunit; Prev. CDC2L4; Cyclin-Dependent Kinase 9 (CDC2-Related Kinase); TAK; Serine/Threonine Protein Kinase PITALRE; Cell Division Protein Kinase 9; Serine/Threonine-Protein Kinase PITALRE; Cyclin-Dependent K

  • AA Sequence

    MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

  • Predicted Molecular Mass

    69.3 kDa

  • Molecular Weight

    Approximately 69 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

1.Supplied as a 0.2 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
2.Supplied as a 0.2 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 10% glycerol, 1 mM DTT.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00