1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. Cyclin-Dependent Kinases (CDKs) CDK
  5. CDK9
  6. CDK9 Protein, Human (sf9, GST)

The CDK9 protein plays a central role in transcriptional regulation, promoting the transition from ineffective to efficient elongation by phosphorylating POLR2A, SUPT5H, and RDBP. As part of the CDK9/cyclin-T complex, it participates in phosphorylation events affecting EP300, MYOD1, RPB1/POLR2A, AR, DSIF, and NELFE. CDK9 Protein, Human (Sf9, GST) is the recombinant human-derived CDK9, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK9 Protein, Human (Sf9, GST) is 372 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CDK9 protein plays a central role in transcriptional regulation, promoting the transition from ineffective to efficient elongation by phosphorylating POLR2A, SUPT5H, and RDBP. As part of the CDK9/cyclin-T complex, it participates in phosphorylation events affecting EP300, MYOD1, RPB1/POLR2A, AR, DSIF, and NELFE. CDK9 Protein, Human (Sf9, GST) is the recombinant human-derived CDK9, expressed by Sf9 insect cells, with GST labeled tag. The total length of CDK9 Protein, Human (Sf9, GST) is 372 a.a..

Background

The CDK9ic protein emerges as a central player in the intricate regulation of transcription, orchestrating a diverse range of cellular processes. As a pivotal member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also known as positive transcription elongation factor b (P-TEFb), it facilitates the transition from abortive to productive elongation by phosphorylating the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), SUPT5H, and RDBP. This complex, inactive in the 7SK small nuclear ribonucleoprotein (snRNP) complex form, engages in phosphorylation events targeting EP300, MYOD1, RPB1/POLR2A, AR, and the negative elongation factors DSIF and NELFE. Beyond its role in transcription, CDK9-CCNK regulates cytokine-inducible transcription networks, promoting RNA synthesis in genetic programs for cell growth, differentiation, and viral pathogenesis. The complex also plays a critical role in cotranscriptional histone modification, mRNA processing, mRNA export, and a network of chromatin modifications. Moreover, it contributes to genome integrity maintenance, replication stress response, and cardiac myocyte enlargement. The multifaceted activities of CDK9-CCNK underscore its significance in governing diverse cellular functions and molecular pathways.

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

P50750-1 (M1-F372)

Gene ID

1025

Protein Length

Full Length of Isoform-1

Synonyms
CDC2L4; TAK
AA Sequence

MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Predicted Molecular Mass
69.3 kDa
Molecular Weight

Approximately 69 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CDK9 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK9 Protein, Human (sf9, GST)
Cat. No.:
HY-P703558
Quantity:
MCE Japan Authorized Agent: