1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. CDNF/MANF family
  5. CDNF
  6. CDNF Protein, Mouse (HEK293, His)

CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. CDNF Protein, Mouse (HEK293, His) is the recombinant mouse-derived CDNF protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. CDNF Protein, Mouse (HEK293, His) is the recombinant mouse-derived CDNF protein, expressed by HEK293 , with C-His labeled tag.

Background

CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a crucial trophic factor for dopamine neurons, exhibiting the ability to counteract the degeneration induced by 6-hydroxydopamine (6-OHDA) in dopaminergic neurons. Particularly notable is its capacity to restore dopaminergic function and shield against the degeneration of neurons in the substantia nigra when administered subsequent to 6-OHDA-induced lesions. This underscores the potential therapeutic relevance of CDNF in mitigating the detrimental effects of neurodegeneration in the context of dopaminergic neurons, offering promise for interventions aimed at preserving and restoring neural function.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q8CC36 (Q25-L187)

Gene ID
Molecular Construction
N-term
CDNF (Q25-L187)
Accession # Q8CC36
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cerebral dopamine neurotrophic factor; CDNF; ARMETL1
AA Sequence

QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL

Predicted Molecular Mass
20 kDa
Peso molecular

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

CDNF Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CDNF Protein, Mouse (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CDNF Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75670
Cantidad:
MCE Japan Authorized Agent: