CDNF Protein, Mouse (HEK293, His)
CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. CDNF Protein, Mouse (HEK293, His) is the recombinant mouse-derived CDNF protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. CDNF Protein, Mouse (HEK293, His) is the recombinant mouse-derived CDNF protein, expressed by HEK293 , with C-His labeled tag.
Background
CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a crucial trophic factor for dopamine neurons, exhibiting the ability to counteract the degeneration induced by 6-hydroxydopamine (6-OHDA) in dopaminergic neurons. Particularly notable is its capacity to restore dopaminergic function and shield against the degeneration of neurons in the substantia nigra when administered subsequent to 6-OHDA-induced lesions. This underscores the potential therapeutic relevance of CDNF in mitigating the detrimental effects of neurodegeneration in the context of dopaminergic neurons, offering promise for interventions aimed at preserving and restoring neural function.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q8CC36 (Q25-L187)
-
Molecular Construction
-
N-term
-
CDNF (Q25-L187)
Accession # Q8CC36 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CDNF; Conserved Dopamine Neurotrophic Factor; Prev. ARMETL1; ARMET-Like Protein 1; Cerebral Dopamine Neurotrophic Factor; Arginine-Rich, Mutated In Early Stage Tumors-Like 1
-
AA Sequence
QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
