1. Recombinant Proteins
  2. Others
  3. CIAO1 Protein, Human (His, StrepⅡ)

CIAO1 protein is a key player in the cytosolic iron-sulfur protein assembly (CIA) complex, interacting with CIAO2A or CIAO2B and MMS19 to affect different iron-sulfur protein assembly pathways. The CIAO1:CIAO2B:MMS19 assembly facilitates most cytoplasmic and nuclear Fe/S proteins, while the CIAO1:CIAO2A complex contributes to ACO1 maturation and IREB2 stabilization. CIAO1 Protein, Human (His, Strep) is the recombinant human-derived CIAO1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CIAO1 protein is a key player in the cytosolic iron-sulfur protein assembly (CIA) complex, interacting with CIAO2A or CIAO2B and MMS19 to affect different iron-sulfur protein assembly pathways. The CIAO1:CIAO2B:MMS19 assembly facilitates most cytoplasmic and nuclear Fe/S proteins, while the CIAO1:CIAO2A complex contributes to ACO1 maturation and IREB2 stabilization. CIAO1 Protein, Human (His, Strep) is the recombinant human-derived CIAO1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

CIAO1 emerges as a pivotal player in the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein entity orchestrating the integration of iron-sulfur clusters into extramitochondrial Fe/S proteins. Its dynamic role within this complex involves specific interactions with CIAO2A or CIAO2B and MMS19, influencing distinct branches of iron-sulfur protein assembly depending on its binding partners. The CIAO1:CIAO2B:MMS19 assembly is particularly involved in facilitating the assembly of most cytosolic-nuclear Fe/S proteins, while the CIAO1:CIAO2A complex specifically contributes to the maturation of ACO1 and stabilization of IREB2. Beyond its involvement in iron-sulfur biogenesis, CIAO1 extends its influence to modulating the transactivation activity of WT1 and participating in chromosome segregation through its association with the mitotic spindle-associated MMXD complex. As an integral component of the CIA complex and various interacting networks, CIAO1 stands as a versatile orchestrator in cellular processes involving iron-sulfur clusters and beyond.

Species

Human

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

O76071 (M1-L339)

Gene ID

9391

Molecular Construction
N-term
StrepⅡ-6*His
CIAO1 (M1-L339)
Accession # O76071
C-term
Protein Length

Full Length

Synonyms
CIAO1; Probable cytosolic iron-sulfur protein assembly protein CIAO1; WD repeat-containing protein 39
AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CIAO1 Protein, Human (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CIAO1 Protein, Human (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CIAO1 Protein, Human (His, StrepⅡ)
Cat. No.:
HY-P702047
Quantity:
MCE Japan Authorized Agent: