1. Recombinant Proteins
  2. Others
  3. CKAP1/TBCB Protein, Human (His)

The CKAP1/TBCB protein plays a key role in the tubulin folding pathway, binding to α-tubulin folding intermediates after chaperone interactions, which is critical for tubulin heterodimer transition. It regulates heterodimer dissociation and may act as a negative regulator of axonal growth. CKAP1/TBCB Protein, Human (His) is the recombinant human-derived CKAP1/TBCB protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CKAP1/TBCB protein plays a key role in the tubulin folding pathway, binding to α-tubulin folding intermediates after chaperone interactions, which is critical for tubulin heterodimer transition. It regulates heterodimer dissociation and may act as a negative regulator of axonal growth. CKAP1/TBCB Protein, Human (His) is the recombinant human-derived CKAP1/TBCB protein, expressed by E. coli , with N-His labeled tag.

Background

The CKAP1/TBCB protein exhibits a multifaceted role in the tubulin folding pathway, binding to alpha-tubulin folding intermediates subsequent to their interaction with cytosolic chaperonin, a pivotal step in the transition from newly synthesized tubulin to properly folded heterodimer. It plays a crucial role in regulating tubulin heterodimer dissociation and may function as a negative regulator of axonal growth. The formation of a supercomplex composed of cofactors A to E is integral to its mechanism. Cofactors A and D function by capturing and stabilizing tubulin in a quasi-native conformation, while cofactor E binds to the cofactor D-tubulin complex. The subsequent interaction with cofactor C leads to the release of tubulin polypeptides committed to the native state. Additionally, cofactors B and E can form a heterodimer that binds to alpha-tubulin, enhancing their capacity to dissociate tubulin heterodimers. CKAP1/TBCB also interacts with GAN and DCTN1, further expanding its functional associations in cellular processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q99426 (M1-I244)

Gene ID
Molecular Construction
N-term
His
CKAP1 (M1-I244)
Accession # Q99426
C-term
Protein Length

Full Length

Synonyms
Tubulin-folding cofactor B; Cytoskeleton-associated protein 1; TBCB; CG22; CKAP1
AA Sequence

MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Predicted Molecular Mass
29.2 kDa
Molecular Weight

Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CKAP1/TBCB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CKAP1/TBCB Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CKAP1/TBCB Protein, Human (His)
Cat. No.:
HY-P77331
Quantity:
MCE Japan Authorized Agent: