CKAP1/TBCB Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The CKAP1/TBCB protein plays a key role in the tubulin folding pathway, binding to α-tubulin folding intermediates after chaperone interactions, which is critical for tubulin heterodimer transition. It regulates heterodimer dissociation and may act as a negative regulator of axonal growth. CKAP1/TBCB Protein, Human (His) is the recombinant human-derived CKAP1/TBCB protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CKAP1/TBCB protein plays a key role in the tubulin folding pathway, binding to α-tubulin folding intermediates after chaperone interactions, which is critical for tubulin heterodimer transition. It regulates heterodimer dissociation and may act as a negative regulator of axonal growth. CKAP1/TBCB Protein, Human (His) is the recombinant human-derived CKAP1/TBCB protein, expressed by E. coli , with N-His labeled tag.

Background

The CKAP1/TBCB protein exhibits a multifaceted role in the tubulin folding pathway, binding to alpha-tubulin folding intermediates subsequent to their interaction with cytosolic chaperonin, a pivotal step in the transition from newly synthesized tubulin to properly folded heterodimer. It plays a crucial role in regulating tubulin heterodimer dissociation and may function as a negative regulator of axonal growth. The formation of a supercomplex composed of cofactors A to E is integral to its mechanism. Cofactors A and D function by capturing and stabilizing tubulin in a quasi-native conformation, while cofactor E binds to the cofactor D-tubulin complex. The subsequent interaction with cofactor C leads to the release of tubulin polypeptides committed to the native state. Additionally, cofactors B and E can form a heterodimer that binds to alpha-tubulin, enhancing their capacity to dissociate tubulin heterodimers. CKAP1/TBCB also interacts with GAN and DCTN1, further expanding its functional associations in cellular processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CKAP1 (M1-I244)
      Accession # Q99426
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    TBCB; Cytoskeleton-Associated Protein 1; Prev. CKAP1; Tubulin-Folding Cofactor B; CG22; CKAPI; Cytoskeleton-Associated Protein CKAPI; Cytoskeleton Associated Protein 1; Tubulin Folding Cofactor B; Tubulin-Specific Chaperone B

  • AA Sequence

    MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

  • Predicted Molecular Mass

    29.2 kDa

  • Molecular Weight

    Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00