CKAP1/TBCB Protein, Human (His)
Based on 1 Customer Validation
The CKAP1/TBCB protein plays a key role in the tubulin folding pathway, binding to α-tubulin folding intermediates after chaperone interactions, which is critical for tubulin heterodimer transition. It regulates heterodimer dissociation and may act as a negative regulator of axonal growth. CKAP1/TBCB Protein, Human (His) is the recombinant human-derived CKAP1/TBCB protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CKAP1/TBCB protein plays a key role in the tubulin folding pathway, binding to α-tubulin folding intermediates after chaperone interactions, which is critical for tubulin heterodimer transition. It regulates heterodimer dissociation and may act as a negative regulator of axonal growth. CKAP1/TBCB Protein, Human (His) is the recombinant human-derived CKAP1/TBCB protein, expressed by E. coli , with N-His labeled tag.
Background
The CKAP1/TBCB protein exhibits a multifaceted role in the tubulin folding pathway, binding to alpha-tubulin folding intermediates subsequent to their interaction with cytosolic chaperonin, a pivotal step in the transition from newly synthesized tubulin to properly folded heterodimer. It plays a crucial role in regulating tubulin heterodimer dissociation and may function as a negative regulator of axonal growth. The formation of a supercomplex composed of cofactors A to E is integral to its mechanism. Cofactors A and D function by capturing and stabilizing tubulin in a quasi-native conformation, while cofactor E binds to the cofactor D-tubulin complex. The subsequent interaction with cofactor C leads to the release of tubulin polypeptides committed to the native state. Additionally, cofactors B and E can form a heterodimer that binds to alpha-tubulin, enhancing their capacity to dissociate tubulin heterodimers. CKAP1/TBCB also interacts with GAN and DCTN1, further expanding its functional associations in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q99426 (M1-I244)
-
Molecular Construction
-
N-term
-
His
-
CKAP1 (M1-I244)
Accession # Q99426 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TBCB; Cytoskeleton-Associated Protein 1; Prev. CKAP1; Tubulin-Folding Cofactor B; CG22; CKAPI; Cytoskeleton-Associated Protein CKAPI; Cytoskeleton Associated Protein 1; Tubulin Folding Cofactor B; Tubulin-Specific Chaperone B
-
AA Sequence
MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
-
Predicted Molecular Mass
29.2 kDa
-
Molecular Weight
Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)