Endotrophin Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1(VI), alpha-2(VI), and alpha-3(VI), alpha-5(VI), or alpha-6(VI). Endotrophin, Human (HEK293, His) is the recombinant human-derived Endotrophin protein, expressed by HEK293, with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1(VI), alpha-2(VI), and alpha-3(VI), alpha-5(VI), or alpha-6(VI). Endotrophin, Human (HEK293, His) is the recombinant human-derived Endotrophin protein, expressed by HEK293, with N-10*His labeled tag.

Background

The COL6A3 protein, part of the collagen VI family, functions as a cell-binding protein. Its structure comprises trimers consisting of three distinct chains: alpha-1(VI), alpha-2(VI), and either alpha-3(VI), alpha-5(VI), or alpha-6(VI). This trimeric composition reflects the diverse nature of collagen VI, allowing for variations in the alpha chains. Notably, collagen VI serves as an essential mediator in cell adhesion processes. The trimeric arrangement, with its distinct alpha chain combinations, underscores the versatility and adaptability of COL6A3 in facilitating cell interactions and highlights its significance in various physiological contexts. (

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • Endotrophin (T3101-T3177)
      Accession # P12111-1
    • C-term
  • Protein Length

    C5 domain of the COL6A3 chain

  • Synonyms

    COL6A3; COL6A3 Protein; Collagen Type VI Alpha 3 Chain; BTHLM1C; Collagen Alpha-3(VI) Chain; BTHLM1; Collagen, Type VI, Alpha 3; UCMD1C; Epididymis Secretory Sperm Binding Protein; DYT27; Collagen VI, Alpha-3 Polypeptide; UCMD1

  • AA Sequence

    TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00