Complement Factor D/Adipsin Protein, Mouse (HEK293, Fc)

Complement Factor D/Adipsin Protein cleaves factor B in complex with factor C3b, activating the C3bbb complex to form the C3 convertase in the alternate pathway, analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-hFc labeled tag.

Complement Factor D/Adipsin Protein functions by cleaving factor B, specifically when it is complexed with factor C3b. This cleavage activates the C3bbb complex, transforming it into the C3 convertase of the alternate pathway. The protein's role is homologous to that of C1s in the classical pathway.

Mouse

HEK293

C-hFc

P03953-1 (I26-S259)

11537  [NCBI]

Full Length of Isoform-1 Mature Protein

ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS

60-70 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 8% mannitol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.