Complement factor H/CFH Protein, Human (372a.a, HEK293, His, solution)
Based on 1 Customer Validation
Complement factor H/CFH proteins regulate complement activation and act as soluble inhibitors to prevent complement amplification on the cell surface. Complement factor H/CFH Protein, Human (372a.a, HEK293, His) is the recombinant human-derived Complement factor H/CFH protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Complement factor H/CFH proteins regulate complement activation and act as soluble inhibitors to prevent complement amplification on the cell surface. Complement factor H/CFH Protein, Human (372a.a, HEK293, His) is the recombinant human-derived Complement factor H/CFH protein, expressed by HEK293 , with C-His labeled tag.
Background
Complement factor H (CFH) Protein, a glycoprotein, assumes a critical role in orchestrating a balanced immune response by finely modulating complement activation. Functioning as a soluble inhibitor, CFH's binding to self markers, such as glycan structures, effectively prevents complement activation and amplification on cell surfaces. It acts to accelerate the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus impeding the local formation of more C3b, a pivotal component in the complement amplification loop. Serving as a cofactor for the serine protease factor I, CFH additionally regulates the proteolytic degradation of already-deposited C3b. Beyond its role in complement regulation, CFH mediates various cellular responses through interactions with specific receptors. For instance, it engages with the CR3/ITGAM receptor, facilitating the adhesion of human neutrophils to diverse pathogens, leading to subsequent phagocytosis and destruction. Notably, in the context of microbial infection, CFH binds to the surface of P.falciparum gametocytes in the mosquito midgut, offering protection against elimination mediated by the alternative complement pathway. The multifaceted activities of CFH underscore its pivotal role in immune regulation and defense against pathogens.
Verified Bioactivity
Measured by its ability to bind biotinylated human DMP-1 in a functional ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P08603-1 (S860-R1231)
-
Gene ID3075
-
Molecular Construction
-
N-term
-
CFH (S860-R1231)
Accession # P08603-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CFH; H Factor 1 (Complement); Prev. HF1; Adrenomedullin Binding Protein; Prev. HF2; Beta-1-H-Globulin; Prev. HF; Factor H-Like 1; ARMS1; H Factor 1; ARMD4; Factor H; FHL1; AHUS1; HUS; AMBP1; Age-Related Maculopathy Susceptibility 1; CFHL3; H Factor 2 (Com
-
AA Sequence
SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
-
Molecular Weight
Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)