1. Recombinant Proteins
  2. Others
  3. COX4NB Protein, Human (His)

COX4NB protein is a component of the endoplasmic reticulum membrane protein complex (EMC) and is able to insert newly synthesized membrane proteins into the endoplasmic reticulum membrane in an energy-independent manner. Its preference for transmembrane domains with weakly hydrophobic or unstable characteristics guides co- and post-translational insertion processes. COX4NB Protein, Human (His) is the recombinant human-derived COX4NB protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

COX4NB protein is a component of the endoplasmic reticulum membrane protein complex (EMC) and is able to insert newly synthesized membrane proteins into the endoplasmic reticulum membrane in an energy-independent manner. Its preference for transmembrane domains with weakly hydrophobic or unstable characteristics guides co- and post-translational insertion processes. COX4NB Protein, Human (His) is the recombinant human-derived COX4NB protein, expressed by E. coli , with N-His labeled tag.

Background

COX4NB protein serves as a crucial component of the endoplasmic reticulum membrane protein complex (EMC), facilitating the energy-independent insertion of newly synthesized membrane proteins into endoplasmic reticulum (ER) membranes. It exhibits a preference for accommodating proteins with transmembrane domains characterized by weak hydrophobicity or containing destabilizing features such as charged and aromatic residues. COX4NB is actively involved in both cotranslational and post-translational insertion processes, playing a key role in the cotranslational insertion of multi-pass membrane proteins where stop-transfer membrane-anchor sequences transform into ER membrane-spanning helices. Additionally, it is essential for the post-translational insertion of tail-anchored (TA) proteins into ER membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, positioning the translocated N-terminus in the ER lumen, COX4NB controls the topology of multi-pass membrane proteins, including G protein-coupled receptors. Indirectly influencing various cellular processes through its regulatory role in protein membrane insertion, COX4NB is a vital component of the EMC complex, where it functions in conjunction with other subunits like EMC8 and EMC9.

Species

Human

Source

E. coli

Tag

N-His

Accession

O43402-1 (M1-C210)

Gene ID
Molecular Construction
N-term
His
COX4NB (M1-C210)
Accession # O43402-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
ER membrane protein complex subunit 8; Neighbor of COX4; C16orf2; COX4AL; COX4NB; FAM158B; NOC4
AA Sequence

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

Predicted Molecular Mass
25.6 kDa
Molecular Weight

Approximately 27 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

COX4NB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

COX4NB Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COX4NB Protein, Human (His)
Cat. No.:
HY-P77342
Quantity:
MCE Japan Authorized Agent: