COX4NB Protein, Human (His)

COX4NB protein is a component of the endoplasmic reticulum membrane protein complex (EMC) and is able to insert newly synthesized membrane proteins into the endoplasmic reticulum membrane in an energy-independent manner. Its preference for transmembrane domains with weakly hydrophobic or unstable characteristics guides co- and post-translational insertion processes. COX4NB Protein, Human (His) is the recombinant human-derived COX4NB protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

COX4NB protein is a component of the endoplasmic reticulum membrane protein complex (EMC) and is able to insert newly synthesized membrane proteins into the endoplasmic reticulum membrane in an energy-independent manner. Its preference for transmembrane domains with weakly hydrophobic or unstable characteristics guides co- and post-translational insertion processes. COX4NB Protein, Human (His) is the recombinant human-derived COX4NB protein, expressed by E. coli , with N-His labeled tag.

Background

COX4NB protein serves as a crucial component of the endoplasmic reticulum membrane protein complex (EMC), facilitating the energy-independent insertion of newly synthesized membrane proteins into endoplasmic reticulum (ER) membranes. It exhibits a preference for accommodating proteins with transmembrane domains characterized by weak hydrophobicity or containing destabilizing features such as charged and aromatic residues. COX4NB is actively involved in both cotranslational and post-translational insertion processes, playing a key role in the cotranslational insertion of multi-pass membrane proteins where stop-transfer membrane-anchor sequences transform into ER membrane-spanning helices. Additionally, it is essential for the post-translational insertion of tail-anchored (TA) proteins into ER membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, positioning the translocated N-terminus in the ER lumen, COX4NB controls the topology of multi-pass membrane proteins, including G protein-coupled receptors. Indirectly influencing various cellular processes through its regulatory role in protein membrane insertion, COX4NB is a vital component of the EMC complex, where it functions in conjunction with other subunits like EMC8 and EMC9.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • COX4NB (M1-C210)
      Accession # O43402-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    EMC8; Family With Sequence Similarity 158, Member B; Prev. C16orf2; Chromosome 16 Open Reading Frame 4; Prev. C16orf4; Chromosome 16 Open Reading Frame 2; Prev. COX4NB; COX4 Neighbor, Isoform CRA_a; Prev. NOC4; Protein FAM158B; Neighbor Of COX4; COX4AL; F

  • AA Sequence

    MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

  • Predicted Molecular Mass

    25.6 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00