COX4NB Protein, Human (His)
COX4NB protein is a component of the endoplasmic reticulum membrane protein complex (EMC) and is able to insert newly synthesized membrane proteins into the endoplasmic reticulum membrane in an energy-independent manner. Its preference for transmembrane domains with weakly hydrophobic or unstable characteristics guides co- and post-translational insertion processes. COX4NB Protein, Human (His) is the recombinant human-derived COX4NB protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
COX4NB protein is a component of the endoplasmic reticulum membrane protein complex (EMC) and is able to insert newly synthesized membrane proteins into the endoplasmic reticulum membrane in an energy-independent manner. Its preference for transmembrane domains with weakly hydrophobic or unstable characteristics guides co- and post-translational insertion processes. COX4NB Protein, Human (His) is the recombinant human-derived COX4NB protein, expressed by E. coli , with N-His labeled tag.
COX4NB protein serves as a crucial component of the endoplasmic reticulum membrane protein complex (EMC), facilitating the energy-independent insertion of newly synthesized membrane proteins into endoplasmic reticulum (ER) membranes. It exhibits a preference for accommodating proteins with transmembrane domains characterized by weak hydrophobicity or containing destabilizing features such as charged and aromatic residues. COX4NB is actively involved in both cotranslational and post-translational insertion processes, playing a key role in the cotranslational insertion of multi-pass membrane proteins where stop-transfer membrane-anchor sequences transform into ER membrane-spanning helices. Additionally, it is essential for the post-translational insertion of tail-anchored (TA) proteins into ER membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, positioning the translocated N-terminus in the ER lumen, COX4NB controls the topology of multi-pass membrane proteins, including G protein-coupled receptors. Indirectly influencing various cellular processes through its regulatory role in protein membrane insertion, COX4NB is a vital component of the EMC complex, where it functions in conjunction with other subunits like EMC8 and EMC9.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O43402-1 (M1-C210)
-
Molecular Construction
-
N-term
-
His
-
COX4NB (M1-C210)
Accession # O43402-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
EMC8; Family With Sequence Similarity 158, Member B; Prev. C16orf2; Chromosome 16 Open Reading Frame 4; Prev. C16orf4; Chromosome 16 Open Reading Frame 2; Prev. COX4NB; COX4 Neighbor, Isoform CRA_a; Prev. NOC4; Protein FAM158B; Neighbor Of COX4; COX4AL; F
-
AA Sequence
MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)