CXCL16 Protein, Mouse (His)
The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. CXCL16 Protein, Mouse (His) is the recombinant mouse-derived CXCL16 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CXCL16 protein has multiple functions, inducing chemotactic responses and initiating calcium mobilization. As a ligand, it binds to CXCR6/Bonzo and promotes cell signaling. CXCL16 Protein, Mouse (His) is the recombinant mouse-derived CXCL16 protein, expressed by E. coli , with N-6*His labeled tag.
Background
The CXCL16 protein exhibits multifaceted functionalities, including the induction of a robust chemotactic response and the initiation of calcium mobilization. Functioning as a ligand, it binds to CXCR6/Bonzo, thereby contributing to cellular signaling processes. Beyond its role as a chemotactic factor, CXCL16 serves as a scavenger receptor on macrophages, displaying a specific affinity for oxidized low-density lipoprotein (OxLDL). This interaction suggests its potential involvement in pathophysiological processes, particularly atherogenesis, where the recognition and clearance of OxLDL by macrophages play a crucial role. The diverse activities of CXCL16 highlight its versatility and underscore its potential implications in cellular responses and pathological conditions.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8BSU2 (N27-T198)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL16 (N27-T198)
Accession # Q8BSU2 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CXCL16; CXCLG16; C-X-C Motif Chemokine Ligand 16; Scavenger Receptor For Phosphatidylserine And Oxidized Low Density Lipoprotein; SR-PSOX; Chemokine (C-X-C Motif) Ligand 16; SRPSOX; Small-Inducible Cytokine B16; Transmembrane Chemokine CXCL16; CXC Chemoki
-
AA Sequence
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST
-
Predicted Molecular Mass
22.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
