Cystatin B/CSTB Protein, Mouse (His)
Cystatin B/CSTB Protein, an intracellular thiol proteinase inhibitor, crucially regulates proteolytic activities within the cell. By inhibiting thiol proteinases, Cystatin B maintains the balance of proteolytic processes, emphasizing its significance in cellular homeostasis. Its inhibitory function underscores involvement in cellular processes requiring precise regulation of proteolytic activity for normal cellular function and integrity. Cystatin B/CSTB Protein, Mouse (His) is the recombinant mouse-derived Cystatin B/CSTB protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cystatin B/CSTB Protein, an intracellular thiol proteinase inhibitor, crucially regulates proteolytic activities within the cell. By inhibiting thiol proteinases, Cystatin B maintains the balance of proteolytic processes, emphasizing its significance in cellular homeostasis. Its inhibitory function underscores involvement in cellular processes requiring precise regulation of proteolytic activity for normal cellular function and integrity. Cystatin B/CSTB Protein, Mouse (His) is the recombinant mouse-derived Cystatin B/CSTB protein, expressed by E. coli , with N-6*His labeled tag.
Background
Cystatin B/CSTB Protein functions as an intracellular thiol proteinase inhibitor. With its role in inhibiting thiol proteinases, this protein contributes to the regulation of intracellular proteolytic activities. By modulating the activity of thiol proteinases, Cystatin B plays a crucial role in maintaining the balance of proteolytic processes within the cell, highlighting its significance in cellular homeostasis. The inhibitory function of Cystatin B against thiol proteinases underscores its involvement in cellular processes where precise regulation of proteolytic activity is essential for normal cellular function and integrity.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q62426 (M1-F98)
-
Molecular Construction
-
N-term
-
6*His
-
CSTB (M1-F98)
Accession # Q62426 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CSTB; Cystatin B (Stefin B); Prev. STFB; CPI-B; Prev. EPM1; Epididymis Secretory Sperm Binding Protein; CST6; Epilepsy, Progressive Myoclonic 1; Cystatin-B; Stefin B; PME; EPM1A; Liver Thiol Proteinase Inhibitor; ULD; Cystatin B; Stefin-B
-
AA Sequence
MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF
-
Predicted Molecular Mass
13.3 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
