2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Protease Inhibitors Cystatin Family
  5. Cystatin B
  6. Cystatin B/CSTB Protein, Mouse (His)

Cystatin B/CSTB Protein, Mouse (His)

Cat. No.: HY-P70137
Handling Instructions

Cystatin B/CSTB Protein, an intracellular thiol proteinase inhibitor, crucially regulates proteolytic activities within the cell. By inhibiting thiol proteinases, Cystatin B maintains the balance of proteolytic processes, emphasizing its significance in cellular homeostasis. Its inhibitory function underscores involvement in cellular processes requiring precise regulation of proteolytic activity for normal cellular function and integrity. Cystatin B/CSTB Protein, Mouse (His) is the recombinant mouse-derived Cystatin B/CSTB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cystatin B/CSTB Protein, Mouse (His) is 98 a.a., with molecular weight of ~15.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin B/CSTB Protein, an intracellular thiol proteinase inhibitor, crucially regulates proteolytic activities within the cell. By inhibiting thiol proteinases, Cystatin B maintains the balance of proteolytic processes, emphasizing its significance in cellular homeostasis. Its inhibitory function underscores involvement in cellular processes requiring precise regulation of proteolytic activity for normal cellular function and integrity. Cystatin B/CSTB Protein, Mouse (His) is the recombinant mouse-derived Cystatin B/CSTB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cystatin B/CSTB Protein, Mouse (His) is 98 a.a., with molecular weight of ~15.0 kDa.
Background

Cystatin B/CSTB Protein functions as an intracellular thiol proteinase inhibitor. With its role in inhibiting thiol proteinases, this protein contributes to the regulation of intracellular proteolytic activities. By modulating the activity of thiol proteinases, Cystatin B plays a crucial role in maintaining the balance of proteolytic processes within the cell, highlighting its significance in cellular homeostasis. The inhibitory function of Cystatin B against thiol proteinases underscores its involvement in cellular processes where precise regulation of proteolytic activity is essential for normal cellular function and integrity.
Species

Mouse
Source

E. coli
Tag

N-6*His
Accession

Q62426 (M1-F98)
Gene ID

13014  [NCBI]
Molecular Construction
N-term
6*His
CSTB (M1-F98)
Accession # Q62426
C-term
Synonyms
rMuCystatin-B, His; CPI-B; CST6cystatin B (liver thiol proteinase inhibitor)10STFBcystatin-B; CSTB; cystatin B (stefinB); Cystatin B; EPM1; Liver thiol proteinase inhibitor; PME; Stefin B; stefin-B
AA Sequence

MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF

Molecular Weight

Approximately 15.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Cystatin B/CSTB Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin B/CSTB Protein, Mouse (His)
Cat. No.:
HY-P70137
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.