1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. DHHC20 Protein, Human (sf9)

DHHC20 Protein, Human (sf9) is the recombinant human-derived DHHC20, expressed by sf9 insect cells , with tag Free labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DHHC20 Protein, Human (sf9) is the recombinant human-derived DHHC20, expressed by sf9 insect cells , with tag Free labeled tag.

Background

DHHC20 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It mediates palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, modulating the duration of EGFR signaling by regulating palmitoylation-dependent EGFR internalization and degradation. This enzyme exhibits a preference for acyl-CoA with C16 fatty acid chains but can also utilize acyl-CoA with C14 and C18 chains. Additionally, DHHC20 may palmitoylate the CALHM1 subunit of gustatory voltage-gated ion channels, influencing channel gating and kinetics. by similar

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q5W0Z9-1 (M1-N365)

Gene ID

253832

Protein Length

Full Length of Isoform-1

Synonyms
Palmitoyltransferase ZDHHC20; Acyltransferase ZDHHC20; 2.3.1.-; DHHC domain-containing cysteine-rich protein 20; DHHC20; Zinc finger DHHC domain-containing protein 20; ZDHHC20; Homo sapiens; Human; Acyltransferase; Transferase; 2.3.1.225
AA Sequence

MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN

Predicted Molecular Mass
42 kDa
Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, pH 7.5, 150 mM NaCl, 0.025% (w/v) DDM, 2 mM TCEP.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

DHHC20 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DHHC20 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DHHC20 Protein, Human (sf9)
Cat. No.:
HY-P703404
Quantity:
MCE Japan Authorized Agent: