DHHC20 Protein, Human (sf9)
Based on 1 Customer Validation
DHHC20 Protein, Human (sf9) is the recombinant human-derived DHHC20, expressed by sf9 insect cells , with tag Free labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DHHC20 Protein, Human (sf9) is the recombinant human-derived DHHC20, expressed by sf9 insect cells , with tag Free labeled tag.
Background
DHHC20 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It mediates palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, modulating the duration of EGFR signaling by regulating palmitoylation-dependent EGFR internalization and degradation. This enzyme exhibits a preference for acyl-CoA with C16 fatty acid chains but can also utilize acyl-CoA with C14 and C18 chains. Additionally, DHHC20 may palmitoylate the CALHM1 subunit of gustatory voltage-gated ion channels, influencing channel gating and kinetics. by similar
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q5W0Z9-1 (M1-N365)
-
Gene ID253832
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ZDHHC20; ZDHHC Palmitoyltransferase 20; Zinc Finger DHHC-Type Palmitoyltransferase 20; DHHC20; DHHC Domain-Containing Cysteine-Rich Protein 20; Zinc Finger DHHC Domain-Containing Protein 20; Zinc Finger DHHC-Type Containing 20; Palmitoyltransferase ZDHHC2
-
AA Sequence
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN
-
Predicted Molecular Mass
42 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of 50 mM HEPES, pH 7.5, 150 mM NaCl, 0.025% (w/v) DDM, 2 mM TCEP.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
