DHHC20 Protein, Human (sf9)

DHHC20 Protein, Human (sf9) is the recombinant human-derived DHHC20, expressed by sf9 insect cells , with tag Free labeled tag.

DHHC20 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It mediates palmitoylation of Cys residues in the cytoplasmic C-terminus of EGFR, modulating the duration of EGFR signaling by regulating palmitoylation-dependent EGFR internalization and degradation. This enzyme exhibits a preference for acyl-CoA with C16 fatty acid chains but can also utilize acyl-CoA with C14 and C18 chains. Additionally, DHHC20 may palmitoylate the CALHM1 subunit of gustatory voltage-gated ion channels, influencing channel gating and kinetics. by similar

Human

Sf9 insect cells

Tag Free

Q5W0Z9-1 (M1-N365)

253832

Full Length of Isoform-1

MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, pH 7.5, 150 mM NaCl, 0.025% (w/v) DDM, 2 mM TCEP.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.