DNASE1L3 Protein, Human (His)

DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (His) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (His) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with C-10*His labeled tag.

Background

DNASE1L3 protein possesses DNA hydrolytic activity, demonstrating proficiency in both single- and double-stranded DNA cleavage, resulting in the production of DNA fragments with 3'-OH ends. The protein can cleave chromatin to nucleosomal units and exhibits activity on nucleosomal and liposome-coated DNA. It plays a crucial role in internucleosomal DNA fragmentation during apoptosis and necrosis, contributing to processes such as myogenic and neuronal differentiation, as well as BCR-mediated clonal deletion of self-reactive B cells. DNASE1L3 is active on chromatin in apoptotic cell-derived membrane-coated microparticles, thereby suppressing anti-DNA autoimmunity. Additionally, in collaboration with DNASE1, DNASE1L3 is essential for degrading neutrophil extracellular traps (NETs), composed mainly of DNA fibers released by neutrophils during inflammation. The degradation of intravascular NETs by DNASE1 and DNASE1L3 is crucial to prevent the formation of clots that could obstruct blood vessels and lead to organ damage following inflammation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • DNASE1L3 (M21-S305)
      Accession # Q13609
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DNASE1L3; Deoxyribonuclease Gamma; Deoxyribonuclease 1L3; Liver And Spleen DNase; DNAS1L3; DNase I-Like 3; LSD; DNaseY; DNase Gamma; DHP2; LS-DNase; Deoxyribonuclease I-Like III; D3; Deoxyribonuclease I Like 3; DNase I Homolog Protein DHP2; DNase I Homolo

  • AA Sequence

    MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

  • Predicted Molecular Mass

    43.1 kDa

  • Molecular Weight

    Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

\

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00