DNASE1L3 Protein, Human (His)
DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (His) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with C-10*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (His) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with C-10*His labeled tag.
DNASE1L3 protein possesses DNA hydrolytic activity, demonstrating proficiency in both single- and double-stranded DNA cleavage, resulting in the production of DNA fragments with 3'-OH ends. The protein can cleave chromatin to nucleosomal units and exhibits activity on nucleosomal and liposome-coated DNA. It plays a crucial role in internucleosomal DNA fragmentation during apoptosis and necrosis, contributing to processes such as myogenic and neuronal differentiation, as well as BCR-mediated clonal deletion of self-reactive B cells. DNASE1L3 is active on chromatin in apoptotic cell-derived membrane-coated microparticles, thereby suppressing anti-DNA autoimmunity. Additionally, in collaboration with DNASE1, DNASE1L3 is essential for degrading neutrophil extracellular traps (NETs), composed mainly of DNA fibers released by neutrophils during inflammation. The degradation of intravascular NETs by DNASE1 and DNASE1L3 is crucial to prevent the formation of clots that could obstruct blood vessels and lead to organ damage following inflammation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-10*His
-
Accession
Q13609 (M21-S305)
-
Gene ID1776
-
Molecular Construction
-
N-term
-
DNASE1L3 (M21-S305)
Accession # Q13609 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DNASE1L3; Deoxyribonuclease Gamma; Deoxyribonuclease 1L3; Liver And Spleen DNase; DNAS1L3; DNase I-Like 3; LSD; DNaseY; DNase Gamma; DHP2; LS-DNase; Deoxyribonuclease I-Like III; D3; Deoxyribonuclease I Like 3; DNase I Homolog Protein DHP2; DNase I Homolo
-
AA Sequence
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
-
Predicted Molecular Mass
43.1 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
\
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)