DPEP3 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

DPEP3 Protein, Human (HEK293, His) is the recombinant human-derived DPEP3 protein, expressed by HEK293, with C-10*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

DPEP3 Protein, Human (HEK293, His) is the recombinant human-derived DPEP3 protein, expressed by HEK293, with C-10*His tag.

Background

DPEP3 lacks dipeptidase activity and cannot hydrolyze cystinyl-bis-glycine, leukotriene D4, or the β-lactam antibiotic imipenem. The absence of activity may result from asparagine (instead of aspartate in DPEP1/2) at position 359 being unable to function as an acid/base catalyst to activate the nucleophilic water/hydroxide. Additionally, tyrosine (instead of histidine) at position 269 reduces affinity for the β-zinc and may cause substrate steric hindrance. by similar: These findings are supported by data from PubMed:32325220.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody .The EC50 is 3.689-7.498 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Q9H4B8 DPEP3 (A36-S463)
      Accession #
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DPEP3; Membrane-Bound Dipeptidase 3; Dipeptidase 3; Dipeptidase 3, Isoform CRA_c; Testis Secretory Sperm-Binding Protein Li 211a; MBD3; Metallopeptidase (Family M19)

  • AA Sequence

    AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS

  • Predicted Molecular Mass

    48.3 kDa

  • Molecular Weight

    Approximately 90 kDa,based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00