DPEP3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
DPEP3 Protein, Human (HEK293, His) is the recombinant human-derived DPEP3 protein, expressed by HEK293, with C-10*His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DPEP3 Protein, Human (HEK293, His) is the recombinant human-derived DPEP3 protein, expressed by HEK293, with C-10*His tag.
Background
DPEP3 lacks dipeptidase activity and cannot hydrolyze cystinyl-bis-glycine, leukotriene D4, or the β-lactam antibiotic imipenem. The absence of activity may result from asparagine (instead of aspartate in DPEP1/2) at position 359 being unable to function as an acid/base catalyst to activate the nucleophilic water/hydroxide. Additionally, tyrosine (instead of histidine) at position 269 reduces affinity for the β-zinc and may cause substrate steric hindrance. by similar: These findings are supported by data from PubMed:32325220.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody .The EC50 is 3.689-7.498 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
Q9H4B8 (A36-S463)
-
Gene ID64180
-
Molecular Construction
-
N-term
-
Q9H4B8 DPEP3 (A36-S463)
Accession # -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DPEP3; Membrane-Bound Dipeptidase 3; Dipeptidase 3; Dipeptidase 3, Isoform CRA_c; Testis Secretory Sperm-Binding Protein Li 211a; MBD3; Metallopeptidase (Family M19)
-
AA Sequence
AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS
-
Predicted Molecular Mass
48.3 kDa
-
Molecular Weight
Approximately 90 kDa,based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
