DPEP3 Protein, Human (HEK293, His)

DPEP3 Protein, Human (HEK293, His) is the recombinant human-derived DPEP3 protein, expressed by HEK293, with C-10*His tag.

DPEP3 lacks dipeptidase activity and cannot hydrolyze cystinyl-bis-glycine, leukotriene D4, or the β-lactam antibiotic imipenem. The absence of activity may result from asparagine (instead of aspartate in DPEP1/2) at position 359 being unable to function as an acid/base catalyst to activate the nucleophilic water/hydroxide. Additionally, tyrosine (instead of histidine) at position 269 reduces affinity for the β-zinc and may cause substrate steric hindrance. by similar: These findings are supported by data from PubMed:32325220.

Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody .The EC₅₀ is 5.322-7.498 ng/mL.

Human

HEK293

C-10*His

Q9H4B8 (A36-S463)

64180

Full Length of Mature Protein

AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS

Approximately 90 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.