1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. E-Selectin/CD62E Selectin
  5. E-Selectin/CD62E Protein, Human (HEK293, His-Avi)

E-Selectin/CD62E Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P78437
Handling Instructions Technical Support

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-Selectin/CD62E Protein, Human (HEK293, His-Avi) is the recombinant human-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-Selectin/CD62E Protein, Human (HEK293, His-Avi) is the recombinant human-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

E-selectin/CD62E Protein is a cell-surface glycoprotein that plays a crucial role in immunoadhesion. It mediates the adhesion of blood neutrophils in cytokine-activated endothelium by interacting with SELPLG/PSGL1. Additionally, E-selectin/CD62E Protein may be involved in capillary morphogenesis. It interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, and it is worth noting that SELPLG sulfation is not necessary for this interaction.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P16581 (W22-P556)

Gene ID
Molecular Construction
N-term
CD62E (W22-P556)
Accession # P16581
8*His-Avi
C-term
Protein Length

Extracellular Domain

Synonyms
CD62E; ELAM; ELAM1; ESEL; E-Selectin; LECAM2; SELE; selectin E; RP1-117P20.2
AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Predicted Molecular Mass
61.6 kDa
Molecular Weight

Approximately 80-100 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

E-Selectin/CD62E Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
E-Selectin/CD62E Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P78437
Quantity:
MCE Japan Authorized Agent: