1. Recombinant Proteins
  2. Others
  3. ECM1 Protein, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Background

ECM1 protein emerges as a multifaceted participant in cellular processes, particularly influencing endochondral bone formation by acting as a negative regulator of bone mineralization. Beyond its role in bone biology, ECM1 extends its influence to endothelial cells, where it stimulates proliferation and fosters angiogenesis. Notably, it exercises regulatory control over MMP9 proteolytic activity, contributing to the intricate balance of molecular events. In its functional repertoire, ECM1 engages in molecular interactions, forming associations with HSPG2, EFEMP1/FBLN3, LAMB3, and MMP9, thereby participating in a network of molecular relationships that underscore its significance in diverse cellular contexts.

Actividad biológica

Measured by the ability of the immobilized protein to support the adhesion of the B16F1 mouse melanoma cells. The adhesion rate for this effect is 39.61% in the presence of 10 μg/mL Rat ECM-1.

Species

Rat

Source

HEK293

Tag

C-10*His

Accession

Q62894/NP_446334.1 (A20-E562)

Gene ID
Molecular Construction
N-term
ECM1 (A20-E562)
Accession # Q62894/NP_446334.1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Extracellular matrix protein 1; Secretory component p85; Ecm1
AA Sequence

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Peso molecular

Approximately 75-80 kDa due to the glycosylation.

Glycosylation
Yes
Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

ECM1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

ECM1 Protein, Rat (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
ECM1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P75264
Cantidad:
MCE Japan Authorized Agent: