1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Hydrolases (EC 3) Deubiquitinase
  4. EIF3S5 Protein, Human (GST)

The EIF3S5 protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various stages of protein synthesis initiation. It stimulates mRNA recruitment, scans for AUG recognition, and promotes disassembly and recycling of posttermination ribosomal complexes within the 43S preinitiation complex (43S PIC). EIF3S5 Protein, Human (GST) is the recombinant human-derived EIF3S5 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EIF3S5 protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various stages of protein synthesis initiation. It stimulates mRNA recruitment, scans for AUG recognition, and promotes disassembly and recycling of posttermination ribosomal complexes within the 43S preinitiation complex (43S PIC). EIF3S5 Protein, Human (GST) is the recombinant human-derived EIF3S5 protein, expressed by E. coli , with N-GST labeled tag.

Background

EIF3S5 protein functions as a vital component of the eukaryotic translation initiation factor 3 (eIF-3) complex, crucial for multiple stages in protein synthesis initiation. This complex associates with the 40S ribosome, facilitating the recruitment of essential factors to form the 43S pre-initiation complex (43S PIC). EIF3S5 within the eIF-3 complex plays a key role in stimulating mRNA recruitment to the 43S PIC and scanning the mRNA for AUG recognition. Additionally, the eIF-3 complex, including EIF3S5, is essential for the disassembly and recycling of post-termination ribosomal complexes, preventing premature joining of the 40S and 60S ribosomal subunits before initiation. Notably, the eIF-3 complex, with EIF3S5 as a component, selectively targets and initiates the translation of a specific subset of mRNAs related to cell proliferation, including those involved in cell cycling, differentiation, and apoptosis. EIF3S5 also exhibits deubiquitinating activity on activated NOTCH1, promoting its nuclear import and thereby acting as a positive regulator of Notch signaling. These diverse functions underscore the critical role of EIF3S5 in coordinating translational initiation and cellular processes with implications for Notch signaling regulation.

Species

Human

Source

E. coli

Tag

N-GST

Accession

O00303 (A2-L357)

Gene ID

8665

Molecular Construction
N-term
GST
EIF3S5 (A2-L357)
Accession # O00303
C-term
Protein Length

Full Length of Mature Protein

Synonyms
EIF3F; Eukaryotic translation initiation factor 3 subunit F; eIF3f; Deubiquitinating enzyme eIF3f; Eukaryotic translation initiation factor 3 subunit 5; eIF-3-epsilon; eIF3 p47
AA Sequence

ATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EIF3S5 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EIF3S5 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF3S5 Protein, Human (GST)
Cat. No.:
HY-P701439
Quantity:
MCE Japan Authorized Agent: