EIF3S5 Protein, Human (GST)

The EIF3S5 protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various stages of protein synthesis initiation. It stimulates mRNA recruitment, scans for AUG recognition, and promotes disassembly and recycling of posttermination ribosomal complexes within the 43S preinitiation complex (43S PIC). EIF3S5 Protein, Human (GST) is the recombinant human-derived EIF3S5 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The EIF3S5 protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various stages of protein synthesis initiation. It stimulates mRNA recruitment, scans for AUG recognition, and promotes disassembly and recycling of posttermination ribosomal complexes within the 43S preinitiation complex (43S PIC). EIF3S5 Protein, Human (GST) is the recombinant human-derived EIF3S5 protein, expressed by E. coli , with N-GST labeled tag.

Background

EIF3S5 protein functions as a vital component of the eukaryotic translation initiation factor 3 (eIF-3) complex, crucial for multiple stages in protein synthesis initiation. This complex associates with the 40S ribosome, facilitating the recruitment of essential factors to form the 43S pre-initiation complex (43S PIC). EIF3S5 within the eIF-3 complex plays a key role in stimulating mRNA recruitment to the 43S PIC and scanning the mRNA for AUG recognition. Additionally, the eIF-3 complex, including EIF3S5, is essential for the disassembly and recycling of post-termination ribosomal complexes, preventing premature joining of the 40S and 60S ribosomal subunits before initiation. Notably, the eIF-3 complex, with EIF3S5 as a component, selectively targets and initiates the translation of a specific subset of mRNAs related to cell proliferation, including those involved in cell cycling, differentiation, and apoptosis. EIF3S5 also exhibits deubiquitinating activity on activated NOTCH1, promoting its nuclear import and thereby acting as a positive regulator of Notch signaling. These diverse functions underscore the critical role of EIF3S5 in coordinating translational initiation and cellular processes with implications for Notch signaling regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • EIF3S5 (A2-L357)
      Accession # O00303
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    EIF3F; Eukaryotic Translation Initiation Factor 3 Subunit 5; Prev. EIF3S5; EIF3f; Deubiquitinating Enzyme EIF3f; Eukaryotic Translation Initiation Factor 3, Subunit 5 (Epsilon, 47kD); EIF-3-Epsilon; Eukaryotic Translation Initiation Factor 3, Subunit F; E

  • AA Sequence

    ATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00