EIF3S5 Protein, Human (GST)

The EIF3S5 protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various stages of protein synthesis initiation. It stimulates mRNA recruitment, scans for AUG recognition, and promotes disassembly and recycling of posttermination ribosomal complexes within the 43S preinitiation complex (43S PIC). EIF3S5 Protein, Human (GST) is the recombinant human-derived EIF3S5 protein, expressed by E. coli , with N-GST labeled tag.

EIF3S5 protein functions as a vital component of the eukaryotic translation initiation factor 3 (eIF-3) complex, crucial for multiple stages in protein synthesis initiation. This complex associates with the 40S ribosome, facilitating the recruitment of essential factors to form the 43S pre-initiation complex (43S PIC). EIF3S5 within the eIF-3 complex plays a key role in stimulating mRNA recruitment to the 43S PIC and scanning the mRNA for AUG recognition. Additionally, the eIF-3 complex, including EIF3S5, is essential for the disassembly and recycling of post-termination ribosomal complexes, preventing premature joining of the 40S and 60S ribosomal subunits before initiation. Notably, the eIF-3 complex, with EIF3S5 as a component, selectively targets and initiates the translation of a specific subset of mRNAs related to cell proliferation, including those involved in cell cycling, differentiation, and apoptosis. EIF3S5 also exhibits deubiquitinating activity on activated NOTCH1, promoting its nuclear import and thereby acting as a positive regulator of Notch signaling. These diverse functions underscore the critical role of EIF3S5 in coordinating translational initiation and cellular processes with implications for Notch signaling regulation.

Human

E. coli

N-GST

O00303 (A2-L357)

8665

Full Length of Mature Protein

ATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.