EphB2 Protein, Human (Active, sf9, GST)
EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, GST) is the recombinant human-derived EphB2, expressed by Sf9 insect cells, with GST labeled tag. The total length of EphB2 Protein, Human (sf9, GST) is 475 a.a..
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, GST) is the recombinant human-derived EphB2, expressed by Sf9 insect cells, with GST labeled tag. The total length of EphB2 Protein, Human (sf9, GST) is 475 a.a..
Background
EphB2 protein is a receptor tyrosine kinase that interacts with transmembrane ephrin-B ligands on neighboring cells, resulting in bidirectional signaling. The pathway downstream of EphB2 is known as forward signaling, while the pathway downstream of ephrin ligands is referred to as reverse signaling. EphB2 plays a crucial role in axon guidance during development, particularly in the guidance of commissural axons connecting the temporal lobes of the cerebral cortex, as well as the guidance of inner ear efferent growth cones and retinal ganglion cell axons. It also regulates the development and maturation of dendritic spines and promotes the formation of excitatory synapses, counteracting the negative regulation mediated by ARHGEF15 upon activation by EFNB1. Furthermore, EphB2 is involved in various developmental processes, including angiogenesis, palate development, and endolymph production in the inner ear. Its complex with EFNB2 controls cell movement and adhesion during the tubularization of the urethra and septation of the cloaca. Additionally, EphB2 may have tumor suppressor activity and could influence platelet activation and blood coagulation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
P29323-1 (L581-G1055)
-
Gene ID2048
-
Protein Length
Partial
-
Synonyms
EPHB2; Ephrin Type-B Receptor 2 Variant; Prev. EPHT3; Protein-Tyrosine Kinase HEK5; Prev. DRT; Elk-Related Tyrosine Kinase; Prev. ERK; ELK-Related Tyrosine Kinase; Tyrosine-Protein Kinase Receptor EPH-3; Eph Tyrosine Kinase 3; Ephrin Type-B Receptor 2; EP
-
AA Sequence
LQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKESNDCSCGG
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)