EphB3 Protein, Human (sf9, GST)
The EphB3 protein is a receptor tyrosine kinase that performs bidirectional signaling with the transmembrane ephrin B ligand. It participates in forward signaling and reverse signaling, sharing functionality with EPHB2. EphB3, Human (sf9, GST) is the recombinant human-derived EphB3 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The EphB3 protein is a receptor tyrosine kinase that performs bidirectional signaling with the transmembrane ephrin B ligand. It participates in forward signaling and reverse signaling, sharing functionality with EPHB2. EphB3, Human (sf9, GST) is the recombinant human-derived EphB3 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
The EphB3 protein is a receptor tyrosine kinase that engages in contact-dependent bidirectional signaling with adjacent cells by binding to transmembrane ephrin-B family ligands. This receptor is involved in both forward signaling, downstream of the receptor, and reverse signaling, downstream of the ephrin ligand. EphB3 shares overlapping and redundant functions with EPHB2, particularly in axon guidance during development, where it regulates the formation of interhemispheric connections in the cerebral cortex. Additionally, EphB3 contributes to the development and maturation of dendritic spines and excitatory synapses, as well as controls cell migration and positioning in various developmental processes such as angiogenesis, palate development, and thymic epithelium development. The EFNB2/EPHB3 complex also plays a role in regulating migration and adhesion of cells involved in the tubularization of the urethra and septation of the cloaca. Lastly, EphB3 is crucial for intestinal epithelium differentiation, distinguishing progenitor cells from differentiated cells within the crypt.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-GST
-
Accession
P54753 (K596-V998)
-
Gene ID2049
-
Molecular Construction
-
N-term
-
GST
-
(K596-V998)
Accession # P54753 -
C-term
-
-
Protein Length
Partial
-
Synonyms
EPHB3; Embryonic Kinase 2; Prev. ETK2; Human Embryo Kinase 2; Tyro6; EPH-Like Kinase 2; Hek2; EphB3; Tyrosine-Protein Kinase TYRO6; TYRO6; EPH-Like Tyrosine Kinase 2; HEK2; Ephrin Type-B Receptor 3; EPH Receptor B3; EK2
-
AA Sequence
KLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)