EPS15 Protein, Human (His)
EPS15 is a multifunctional protein that regulates cell growth, controls mitotic signaling, and contributes to receptor tyrosine kinase (RTK) internalization, particularly affecting EGFR. As a clathrin adapter, EPS15 is critical for the assembly and maturation of clathrin-coated pits (CCP), affecting the endocytosis of molecules such as ITGB1 and transferrin receptor (TFR). EPS15 Protein, Human (His) is the recombinant human-derived EPS15 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
EPS15 is a multifunctional protein that regulates cell growth, controls mitotic signaling, and contributes to receptor tyrosine kinase (RTK) internalization, particularly affecting EGFR. As a clathrin adapter, EPS15 is critical for the assembly and maturation of clathrin-coated pits (CCP), affecting the endocytosis of molecules such as ITGB1 and transferrin receptor (TFR). EPS15 Protein, Human (His) is the recombinant human-derived EPS15 protein, expressed by E. coli , with N-6*His labeled tag.
Background
EPS15, a multifaceted protein, intricately regulates cell growth and plays a pivotal role in the control of mitogenic signals and cell proliferation. It is particularly involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) family, with a notable impact on EGFR internalization. Functioning as a clathrin adapter, EPS15 is indispensable for the assembly of clathrin-coated pits (CCPs) and contributes to CCPs' maturation, including processes like invagination or budding. Its involvement extends to endocytosis of key molecules such as integrin beta-1 (ITGB1) and transferrin receptor (TFR), with the internalization of ITGB1 relying on its association with DAB2. EPS15 engages in a complex network of protein interactions, including SGIP1, HGS, STAM, STAM2, AP2A2, STON2, CRK, SH3BP4/TTP, ERBB2, FCHO1, FCHO2, DAB2, CORO7, UBQLN1, UBQLN2, REPS2, and EPN1, underscoring its versatility and significance in various cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P42566-1 (C657-D798)
-
Molecular Construction
-
N-term
-
6*His
-
EPS15 (C657-D798)
Accession # P42566-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
EPS15; AF1P; Epidermal Growth Factor Receptor Pathway Substrate 15; ALL1 Fused Gene From Chromosome 1; Epidermal Growth Factor Receptor Substrate 15; Protein Eps15; Protein AF-1p; KMT2A Fusion; AF-1P; KMT2A; MLLT5
-
AA Sequence
CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
-
Predicted Molecular Mass
20.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)