ETV6 Protein, Human (His, Strep)
ETV6 Protein, Human (His, Strep) is the recombinant human-derived ETV6, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ETV6 Protein, Human (His, Strep) is the recombinant human-derived ETV6, expressed by E. coli , with Strep, His labeled tag.
ETV6 is a transcriptional repressor that binds to the DNA sequence 5'-CCGGAAGT-3'. It plays a role in hematopoiesis and malignant transformation. by similar: Other studies indicate that aberrant expression or mutations of ETV6 are associated with various hematologic malignancies.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P41212 (C338-E451)
-
Gene ID2120
-
Protein Length
Partial
-
Synonyms
ETV6; ETS Variant 6; ETS Variant Transcription Factor 6; TEL1 Oncogene; TEL; TEL Oncogene; Transcription Factor ETV6; ETV6 Protein; ETS-Related Protein Tel1; TEL/ABL; Ets Variant Gene 6 (TEL Oncogene); THC5; ETS Translocation Variant 6; TEL1; ETV6-RUNX1 F
-
AA Sequence
CRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELDEQIYQEDE
-
Predicted Molecular Mass
17.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
