FABP5 Protein, Human
Based on 1 Customer Validation
FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human is the recombinant human-derived FABP5 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human is the recombinant human-derived FABP5 protein, expressed by E. coli , with tag free.
FABP5 functions as an intracellular carrier for long-chain fatty acids and related active lipids, including endocannabinoids, thereby regulating the metabolism and actions of the ligands they bind. In addition to its role in cytosolic transport, FABP5 selectively delivers specific fatty acids from the cytosol to the nucleus, where they activate nuclear receptors. Notably, it delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 may also serve as a synaptic carrier of endocannabinoids at central synapses, thereby controlling retrograde endocannabinoid signaling. Furthermore, it modulates inflammation by regulating PTGES induction via NF-kappa-B activation and prostaglandin E2 (PGE2) biosynthesis during inflammatory processes. Additionally, FABP5's potential involvement in keratinocyte differentiation has been suggested.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q01469 (M1-E135)
-
Molecular Construction
-
N-term
-
FABP5 (M1-E135)
Accession # Q01469 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FABP5; Psoriasis-Associated Fatty Acid-Binding Protein Homolog; Fatty Acid Binding Protein 5; Epidermal-Type Fatty Acid-Binding Protein; PA-FABP; Fatty Acid-Binding Protein 5; E-FABP; Fatty Acid-Binding Protein, Epidermal; Fatty Acid Binding Protein 5 (Ps
-
AA Sequence
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
