FGF-17 Protein, Human

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human is the recombinant human-derived FGF-17 protein, expressed by E. coli , with tag free.

FGF-17 Protein assumes a crucial role in regulating embryonic development and serves as a signaling molecule in the induction and patterning of the embryonic brain. Its presence is essential for normal brain development, emphasizing its significance in shaping the intricate processes of embryogenesis. Notably, FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in intricate signaling cascades that contribute to the precise orchestration of developmental events in the embryonic brain.

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 99.77 ng/mL in the presence of 1 µg/mL heparin, corresponding to a specific activity is 1.002×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 99.77 ng/mL in the presence of 1 µg/mL heparin, corresponding to a specific activity is 1.002×10⁴ units/mg.

Human

E. coli

Tag Free

O60258 (T23-T216)

8822  [NCBI]

Full Length of Mature Protein

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Less than 1 EU/µg as determined by LAL test.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.