FGF basic/bFGF protein, Bovine (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FFGF basic/bFGF protein, Bovine (His)) is the recombinant bovine-derived FGF2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Bovine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FGF2 protein is a multifunctional ligand that can bind to FGFR1, FGFR2, FGFR3 and FGFR4. It is also a key integrin ligand for FGF2 signal transduction and has an important interaction with the integrin ITGAV:ITGB3. FGF2 plays a critical role in cell survival, division, differentiation, and migration, serves as a potent mitogen, and induces angiogenesis. FFGF basic/bFGF protein, Bovine (His)) is the recombinant bovine-derived FGF2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

FGF2 Protein serves as a versatile ligand, binding to FGFR1, FGFR2, FGFR3, and FGFR4, and also functions as an integrin ligand crucial for FGF2 signaling. The interaction with integrin ITGAV:ITGB3 is essential for this signaling pathway. FGF2 plays a pivotal role in regulating cell survival, cell division, cell differentiation, and cell migration. Additionally, it acts as a potent mitogen in vitro and has the capability to induce angiogenesis. FGF2's influence extends to promoting retinal lens fiber differentiation through the phosphorylation of ERK1/2. Existing as a monomer or homodimer, FGF2 interacts with its receptors FGFR1, FGFR2, FGFR3, and FGFR4, and its affinity for these receptors is enhanced by heparan sulfate glycosaminoglycans. Furthermore, FGF2 forms complexes with other proteins such as CSPG4, FGFBP1, TEC, and FGFBP3, contributing to its diverse cellular functions. The interaction with integrin ITGAV:ITGB3 is indispensable for FGF2 signaling, and additional interactions with SNORC and glypican GPC3 further illustrate the intricate network of FGF2-associated proteins.

Technical Parameters

  • Species Bovine
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • FGF basic/bFGF (P10-S155)
      Accession # P03969
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF2; BFGF; Prev. FGFB; Basic Fibroblast Growth Factor; Fibroblast Growth Factor 2 (Basic); Fibroblast Growth Factor; Heparin-Binding Growth Factor 2; Prostatropin; HBGF-2; FGF2A; FGF-2; FGF; Fibroblast Growth Factor 2; Basic Fibroblast Growth Factor BFGF

  • AA Sequence

    PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

  • Predicted Molecular Mass

    20.5 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00