FOLR2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
FOLR2 Protein, crucial for binding folate and its derivatives, facilitates their transport into cells with notable affinity under neutral pH. Upon endocytosis and exposure to slightly acidic pH, FOLR2 undergoes a conformational change, significantly reducing its affinity for folates and releasing them from the receptor, similar to other proteins. FOLR2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FOLR2 Protein, crucial for binding folate and its derivatives, facilitates their transport into cells with notable affinity under neutral pH. Upon endocytosis and exposure to slightly acidic pH, FOLR2 undergoes a conformational change, significantly reducing its affinity for folates and releasing them from the receptor, similar to other proteins. FOLR2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.
Background
The FOLR2 protein plays a pivotal role in binding to folate and reduced folic acid derivatives, facilitating the transport of 5-methyltetrahydrofolate and folate analogs into the intracellular space. It exhibits a remarkable affinity for folate and folic acid analogs under neutral pH conditions. However, upon receptor endocytosis, exposure to a slightly acidic pH induces a conformational change in FOLR2, leading to a substantial reduction in its affinity for folates and subsequent release from the receptor, as observed in similar proteins.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q05685 (R21-S227)
-
Molecular Construction
-
N-term
-
FOLR2 (R21-S227)
Accession # Q05685 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FOLR2; FOLR2 Protein; Folate Receptor Beta; BETA-HFR; Folate Receptor, Fetal/Placental; FBP/PL-1; Placental Folate-Binding Protein; FR-BETA; Folate Receptor 2 (Fetal); FR-Beta; FBP; FRbeta; Folate-Binding Protein, Fetal/Placental; FR-P3; Folate Receptor A
-
AA Sequence
RDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCSVNTSQELHKADSRLYFNWDHCGKMEPACKSHFIQDSCLYECSPNLGPWIQQVDQSWRKERFLDVPLCKEDCHQWWEACRTSFTCKRDWHKGWDWSSGINKCPNTAPCHTFEYYFPTPASLCEGLWSHSYKVSNYSRGSGRCIQMWFDSTQGNPNEDVVKFYASFMTS
-
Predicted Molecular Mass
25.3 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
